Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 491157..491707 Replicon chromosome
Accession NZ_CP100670
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain R17.0904

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag NL713_RS02355 Protein ID WP_001199743.1
Coordinates 491399..491707 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V7ITQ8
Locus tag NL713_RS02350 Protein ID WP_000016244.1
Coordinates 491157..491396 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL713_RS02320 (487083) 487083..487613 + 531 WP_017441181.1 gluconokinase -
NL713_RS02325 (487641) 487641..488660 - 1020 WP_000152563.1 NAD(P)-dependent alcohol dehydrogenase -
NL713_RS02335 (489418) 489418..490395 + 978 WP_223195356.1 IS630 family transposase -
NL713_RS02340 (490415) 490415..490723 + 309 Protein_449 DUF4942 domain-containing protein -
NL713_RS02345 (490824) 490824..491048 + 225 WP_031233173.1 ribbon-helix-helix protein, CopG family -
NL713_RS02350 (491157) 491157..491396 + 240 WP_000016244.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NL713_RS02355 (491399) 491399..491707 + 309 WP_001199743.1 CcdB family protein Toxin
NL713_RS02360 (492074) 492074..493000 - 927 WP_017441178.1 site-specific integrase -
NL713_RS02365 (492990) 492990..494609 - 1620 WP_017441177.1 MobH family relaxase -
NL713_RS02370 (494900) 494900..495355 - 456 WP_031615695.1 NUDIX domain-containing protein -
NL713_RS02375 (495461) 495461..496372 - 912 WP_017441175.1 zincin-like metallopeptidase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 489463..505897 16434
- flank IS/Tn - - 489463..490395 932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T250944 WP_001199743.1 NZ_CP100670:491399-491707 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8709.86 Da        Isoelectric Point: 6.4633

>AT250944 WP_000016244.1 NZ_CP100670:491157-491396 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5I5T4R8

References