Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 303886..304667 | Replicon | chromosome |
Accession | NZ_CP100670 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain R17.0904 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A3G3E5T9 |
Locus tag | NL713_RS01390 | Protein ID | WP_000625911.1 |
Coordinates | 304176..304667 (+) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | V7IUD2 |
Locus tag | NL713_RS01385 | Protein ID | WP_001271379.1 |
Coordinates | 303886..304179 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL713_RS01350 (300188) | 300188..301093 | + | 906 | WP_254520487.1 | YjiK family protein | - |
NL713_RS01355 (301387) | 301387..301581 | - | 195 | WP_223195369.1 | hypothetical protein | - |
NL713_RS01360 (301629) | 301629..301728 | - | 100 | Protein_258 | hypothetical protein | - |
NL713_RS01365 (301748) | 301748..301915 | + | 168 | WP_071527476.1 | ATP-binding cassette domain-containing protein | - |
NL713_RS01370 (301922) | 301922..302209 | - | 288 | WP_072103482.1 | transcriptional regulator RtsB | - |
NL713_RS01375 (302206) | 302206..303081 | - | 876 | WP_017441228.1 | AraC family transcriptional regulator | - |
NL713_RS01380 (303347) | 303347..303568 | - | 222 | WP_001595143.1 | hypothetical protein | - |
NL713_RS01385 (303886) | 303886..304179 | + | 294 | WP_001271379.1 | DUF1778 domain-containing protein | Antitoxin |
NL713_RS01390 (304176) | 304176..304667 | + | 492 | WP_000625911.1 | GNAT family N-acetyltransferase | Toxin |
NL713_RS01395 (304882) | 304882..305130 | + | 249 | Protein_265 | IS481 family transposase | - |
NL713_RS01400 (305376) | 305376..305633 | - | 258 | WP_001112996.1 | hypothetical protein | - |
NL713_RS01405 (306226) | 306226..306510 | + | 285 | WP_192917775.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
NL713_RS01410 (306545) | 306545..307084 | + | 540 | WP_000721295.1 | type 1 fimbrial protein | - |
NL713_RS01415 (307094) | 307094..309532 | + | 2439 | WP_017441226.1 | F4 (K88) fimbrial usher FaeD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeC / faeD / faeE / faeF / faeH / faeI | 302206..317160 | 14954 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17663.44 Da Isoelectric Point: 7.2655
>T250942 WP_000625911.1 NZ_CP100670:304176-304667 [Salmonella enterica subsp. enterica serovar Mbandaka]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10938.54 Da Isoelectric Point: 9.8590
>AT250942 WP_001271379.1 NZ_CP100670:303886-304179 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G3E5T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V7IUD2 |