Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4242978..4243564 Replicon chromosome
Accession NZ_CP100666
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain R18.1630

Toxin (Protein)


Gene name doc Uniprot ID A0A3V9X0E4
Locus tag NL709_RS20880 Protein ID WP_000174964.1
Coordinates 4242978..4243346 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID V7IU48
Locus tag NL709_RS20885 Protein ID WP_001522145.1
Coordinates 4243343..4243564 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL709_RS20860 (4238497) 4238497..4239567 - 1071 WP_000907840.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
NL709_RS20865 (4239569) 4239569..4240414 - 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NL709_RS20870 (4240411) 4240411..4241298 - 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NL709_RS20875 (4241403) 4241403..4242719 - 1317 WP_000624755.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NL709_RS20880 (4242978) 4242978..4243346 - 369 WP_000174964.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL709_RS20885 (4243343) 4243343..4243564 - 222 WP_001522145.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL709_RS20890 (4243695) 4243695..4244408 - 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NL709_RS20895 (4244410) 4244410..4245177 - 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NL709_RS20900 (4245174) 4245174..4246451 - 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
NL709_RS20905 (4246448) 4246448..4247374 - 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NL709_RS20910 (4247434) 4247434..4248543 - 1110 WP_000822978.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4237760..4249347 11587


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-114)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13601.91 Da        Isoelectric Point: 6.7252

>T250937 WP_000174964.1 NZ_CP100666:c4243346-4242978 [Salmonella enterica subsp. enterica serovar Enteritidis]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8166.17 Da        Isoelectric Point: 5.0775

>AT250937 WP_001522145.1 NZ_CP100666:c4243564-4243343 [Salmonella enterica subsp. enterica serovar Enteritidis]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V9X0E4

Antitoxin

Source ID Structure

References