Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1076673..1077293 | Replicon | chromosome |
Accession | NZ_CP100666 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain R18.1630 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NL709_RS05065 | Protein ID | WP_001280991.1 |
Coordinates | 1076673..1076891 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NL709_RS05070 | Protein ID | WP_000344807.1 |
Coordinates | 1076919..1077293 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL709_RS05025 (1071896) | 1071896..1072465 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
NL709_RS05030 (1072498) | 1072498..1072887 | - | 390 | WP_000961287.1 | MGMT family protein | - |
NL709_RS05040 (1073118) | 1073118..1074668 | - | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
NL709_RS05045 (1074893) | 1074893..1075153 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NL709_RS05050 (1075159) | 1075159..1075299 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NL709_RS05055 (1075355) | 1075355..1075825 | - | 471 | WP_000136183.1 | YlaC family protein | - |
NL709_RS05060 (1075943) | 1075943..1076494 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
NL709_RS05065 (1076673) | 1076673..1076891 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NL709_RS05070 (1076919) | 1076919..1077293 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NL709_RS05075 (1077789) | 1077789..1080938 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NL709_RS05080 (1080961) | 1080961..1082154 | - | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T250926 WP_001280991.1 NZ_CP100666:c1076891-1076673 [Salmonella enterica subsp. enterica serovar Enteritidis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT250926 WP_000344807.1 NZ_CP100666:c1077293-1076919 [Salmonella enterica subsp. enterica serovar Enteritidis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|