Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 456960..457510 Replicon chromosome
Accession NZ_CP100666
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain R18.1630

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag NL709_RS02200 Protein ID WP_001199743.1
Coordinates 457202..457510 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag NL709_RS02195 Protein ID WP_001118105.1
Coordinates 456960..457199 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL709_RS02160 (452399) 452399..453430 - 1032 WP_000453347.1 L-idonate 5-dehydrogenase -
NL709_RS02165 (453647) 453647..454177 + 531 WP_000896758.1 gluconokinase -
NL709_RS02170 (454205) 454205..455224 - 1020 WP_000152558.1 NAD(P)-dependent alcohol dehydrogenase -
NL709_RS02180 (455981) 455981..456412 + 432 Protein_417 helix-turn-helix domain-containing protein -
NL709_RS02185 (456443) 456443..456526 + 84 WP_228958541.1 DUF4942 domain-containing protein -
NL709_RS02190 (456603) 456603..456851 + 249 WP_000168388.1 ribbon-helix-helix domain-containing protein -
NL709_RS02195 (456960) 456960..457199 + 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NL709_RS02200 (457202) 457202..457510 + 309 WP_001199743.1 CcdB family protein Toxin
NL709_RS02205 (457916) 457916..458056 + 141 Protein_422 Arm DNA-binding domain-containing protein -
NL709_RS02210 (458088) 458088..459221 - 1134 Protein_423 IS3 family transposase -
NL709_RS02215 (459544) 459544..460074 + 531 WP_000909461.1 SEF14 fimbria major subunit SefA -
NL709_RS02220 (460196) 460196..460936 + 741 WP_001676217.1 SEF14/SEF18 fimbria chaperone SefB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 456026..459129 3103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T250922 WP_001199743.1 NZ_CP100666:457202-457510 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT250922 WP_001118105.1 NZ_CP100666:456960-457199 [Salmonella enterica subsp. enterica serovar Enteritidis]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References