Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 415869..416385 | Replicon | chromosome |
Accession | NZ_CP100666 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain R18.1630 |
Toxin (Protein)
Gene name | relE | Uniprot ID | B5R9I9 |
Locus tag | NL709_RS01985 | Protein ID | WP_000220582.1 |
Coordinates | 416101..416385 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | NL709_RS01980 | Protein ID | WP_000212724.1 |
Coordinates | 415869..416111 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL709_RS01960 (410889) | 410889..412022 | + | 1134 | WP_000459957.1 | amidohydrolase/deacetylase family metallohydrolase | - |
NL709_RS01965 (412006) | 412006..413124 | + | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NL709_RS01970 (413121) | 413121..413861 | + | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
NL709_RS01975 (413878) | 413878..415791 | + | 1914 | WP_001212142.1 | BglG family transcription antiterminator | - |
NL709_RS01980 (415869) | 415869..416111 | + | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NL709_RS01985 (416101) | 416101..416385 | + | 285 | WP_000220582.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL709_RS01990 (416389) | 416389..416853 | - | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NL709_RS01995 (416975) | 416975..419113 | - | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NL709_RS02000 (419522) | 419522..421174 | - | 1653 | WP_000155048.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.66 Da Isoelectric Point: 9.6743
>T250921 WP_000220582.1 NZ_CP100666:416101-416385 [Salmonella enterica subsp. enterica serovar Enteritidis]
MTYELEFDPRALKEWHKLGDTVQAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVQAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656ILJ8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |