Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5634900..5635506 | Replicon | chromosome |
Accession | NZ_CP100660 | ||
Organism | Pseudomonas fluorescens strain ZL22 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | NLL86_RS26020 | Protein ID | WP_254485629.1 |
Coordinates | 5635171..5635506 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | - |
Locus tag | NLL86_RS26015 | Protein ID | WP_254481896.1 |
Coordinates | 5634900..5635148 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLL86_RS25990 (NLL86_25990) | 5630268..5630438 | + | 171 | Protein_5097 | integrase | - |
NLL86_RS25995 (NLL86_25995) | 5630435..5630827 | + | 393 | WP_254481883.1 | hypothetical protein | - |
NLL86_RS26000 (NLL86_26000) | 5630988..5632892 | + | 1905 | WP_254481892.1 | AAA family ATPase | - |
NLL86_RS26005 (NLL86_26005) | 5633767..5634219 | - | 453 | WP_254481893.1 | DUF2442 domain-containing protein | - |
NLL86_RS26010 (NLL86_26010) | 5634590..5634790 | + | 201 | WP_254481895.1 | hypothetical protein | - |
NLL86_RS26015 (NLL86_26015) | 5634900..5635148 | + | 249 | WP_254481896.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NLL86_RS26020 (NLL86_26020) | 5635171..5635506 | + | 336 | WP_254485629.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLL86_RS26025 (NLL86_26025) | 5635536..5637833 | - | 2298 | WP_254481898.1 | TonB-dependent siderophore receptor | - |
NLL86_RS26030 (NLL86_26030) | 5637974..5638693 | + | 720 | WP_254481901.1 | response regulator transcription factor | - |
NLL86_RS26035 (NLL86_26035) | 5638695..5640074 | + | 1380 | WP_254481904.1 | ATP-binding protein | - |
NLL86_RS26040 (NLL86_26040) | 5640071..5640496 | - | 426 | WP_254481906.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 5617594..5635506 | 17912 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12690.39 Da Isoelectric Point: 5.5433
>T250919 WP_254485629.1 NZ_CP100660:5635171-5635506 [Pseudomonas fluorescens]
IIRFTDSASQRIEDQVHHRAVYHGTQTALQKITALVDSIEQRLSAAPVGYPVSPQASDLGVMQYRELNVDGYRVFYEIFE
DDHTIAVELVVRQKQSVEQALIRYCLIYPLP
IIRFTDSASQRIEDQVHHRAVYHGTQTALQKITALVDSIEQRLSAAPVGYPVSPQASDLGVMQYRELNVDGYRVFYEIFE
DDHTIAVELVVRQKQSVEQALIRYCLIYPLP
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|