Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 4730625..4731253 | Replicon | chromosome |
| Accession | NZ_CP100660 | ||
| Organism | Pseudomonas fluorescens strain ZL22 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NLL86_RS21750 | Protein ID | WP_254481170.1 |
| Coordinates | 4731068..4731253 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NLL86_RS21745 | Protein ID | WP_254481169.1 |
| Coordinates | 4730625..4731050 (-) | Length | 142 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLL86_RS21720 (NLL86_21720) | 4726234..4726728 | + | 495 | WP_254481164.1 | DUF6231 family protein | - |
| NLL86_RS21725 (NLL86_21725) | 4726731..4727207 | + | 477 | WP_254481165.1 | YchJ family protein | - |
| NLL86_RS21730 (NLL86_21730) | 4727210..4727686 | + | 477 | WP_254481166.1 | LEA type 2 family protein | - |
| NLL86_RS21735 (NLL86_21735) | 4727694..4727897 | + | 204 | WP_254481167.1 | SEC-C metal-binding domain-containing protein | - |
| NLL86_RS21740 (NLL86_21740) | 4728138..4730579 | + | 2442 | WP_254481168.1 | penicillin acylase family protein | - |
| NLL86_RS21745 (NLL86_21745) | 4730625..4731050 | - | 426 | WP_254481169.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NLL86_RS21750 (NLL86_21750) | 4731068..4731253 | - | 186 | WP_254481170.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NLL86_RS21755 (NLL86_21755) | 4731550..4731891 | + | 342 | WP_254481171.1 | hypothetical protein | - |
| NLL86_RS21760 (NLL86_21760) | 4731996..4733012 | + | 1017 | WP_254481172.1 | ligase-associated DNA damage response exonuclease | - |
| NLL86_RS21765 (NLL86_21765) | 4733009..4734667 | + | 1659 | WP_254481173.1 | ATP-dependent DNA ligase | - |
| NLL86_RS21770 (NLL86_21770) | 4734766..4735881 | + | 1116 | WP_254481174.1 | M14 family metallopeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7051.21 Da Isoelectric Point: 10.8456
>T250917 WP_254481170.1 NZ_CP100660:c4731253-4731068 [Pseudomonas fluorescens]
MKYSEFRRWLRARGVTFVPAKGSHFKVYLGNRQTIFPDHGGKEIGEGLRRKILKDLGLSEC
MKYSEFRRWLRARGVTFVPAKGSHFKVYLGNRQTIFPDHGGKEIGEGLRRKILKDLGLSEC
Download Length: 186 bp
Antitoxin
Download Length: 142 a.a. Molecular weight: 15603.96 Da Isoelectric Point: 4.7969
>AT250917 WP_254481169.1 NZ_CP100660:c4731050-4730625 [Pseudomonas fluorescens]
MTFDYPVIIHREAGSVWISCPDVPEMSSAGDTEEEALFDAVDAMESALSFYVDQKIAIPLPAERSADLPVVRLPALTAAK
AALWNTMVEQKVSKTEMARRLGVNRPQVDRLVDLLHRSKIEQVEHALHVLGQRIELAVVTA
MTFDYPVIIHREAGSVWISCPDVPEMSSAGDTEEEALFDAVDAMESALSFYVDQKIAIPLPAERSADLPVVRLPALTAAK
AALWNTMVEQKVSKTEMARRLGVNRPQVDRLVDLLHRSKIEQVEHALHVLGQRIELAVVTA
Download Length: 426 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|