Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 3576909..3577425 | Replicon | chromosome |
Accession | NZ_CP100660 | ||
Organism | Pseudomonas fluorescens strain ZL22 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NLL86_RS16400 | Protein ID | WP_254480407.1 |
Coordinates | 3576909..3577190 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NLL86_RS16405 | Protein ID | WP_254480408.1 |
Coordinates | 3577180..3577425 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLL86_RS16380 (NLL86_16380) | 3572226..3573248 | - | 1023 | WP_254480403.1 | histone deacetylase family protein | - |
NLL86_RS16385 (NLL86_16385) | 3573248..3574489 | - | 1242 | WP_254480404.1 | Zn-dependent hydrolase | - |
NLL86_RS16390 (NLL86_16390) | 3574520..3575824 | - | 1305 | WP_254480405.1 | MFS transporter | - |
NLL86_RS16395 (NLL86_16395) | 3576004..3576912 | + | 909 | WP_254480406.1 | LysR family transcriptional regulator | - |
NLL86_RS16400 (NLL86_16400) | 3576909..3577190 | - | 282 | WP_254480407.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLL86_RS16405 (NLL86_16405) | 3577180..3577425 | - | 246 | WP_254480408.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NLL86_RS16410 (NLL86_16410) | 3577661..3578203 | + | 543 | WP_254485587.1 | WYL domain-containing protein | - |
NLL86_RS16415 (NLL86_16415) | 3578302..3579237 | + | 936 | WP_254480409.1 | cyclase family protein | - |
NLL86_RS16420 (NLL86_16420) | 3579249..3580259 | - | 1011 | WP_254480410.1 | AraC family transcriptional regulator | - |
NLL86_RS16425 (NLL86_16425) | 3580428..3581612 | + | 1185 | WP_254480411.1 | acetyl-CoA C-acyltransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10836.66 Da Isoelectric Point: 10.6500
>T250916 WP_254480407.1 NZ_CP100660:c3577190-3576909 [Pseudomonas fluorescens]
MTYKLEFLPSALKEWGKTGHTVREQLKKKLGERLQSPKVQADALRDMPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
REHGEVYRAAQKR
MTYKLEFLPSALKEWGKTGHTVREQLKKKLGERLQSPKVQADALRDMPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
REHGEVYRAAQKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|