Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1595846..1596503 | Replicon | chromosome |
| Accession | NZ_CP100653 | ||
| Organism | Pseudomonas aeruginosa strain F13 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A8G3IXE4 |
| Locus tag | NLS69_RS07560 | Protein ID | WP_003098540.1 |
| Coordinates | 1596321..1596503 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NLS69_RS07555 | Protein ID | WP_254575228.1 |
| Coordinates | 1595846..1596274 (-) | Length | 143 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLS69_RS07520 (NLS69_07520) | 1591150..1591905 | - | 756 | WP_254575225.1 | helix-turn-helix transcriptional regulator | - |
| NLS69_RS07525 (NLS69_07525) | 1592502..1593263 | + | 762 | WP_254575226.1 | helix-turn-helix domain-containing protein | - |
| NLS69_RS07530 (NLS69_07530) | 1593260..1593943 | + | 684 | WP_254575227.1 | replication protein P | - |
| NLS69_RS07535 (NLS69_07535) | 1593940..1594146 | + | 207 | WP_003159465.1 | hypothetical protein | - |
| NLS69_RS07540 (NLS69_07540) | 1594143..1594724 | + | 582 | WP_021205616.1 | recombination protein NinG | - |
| NLS69_RS07545 (NLS69_07545) | 1594721..1595017 | + | 297 | WP_043486973.1 | hypothetical protein | - |
| NLS69_RS07550 (NLS69_07550) | 1595055..1595729 | + | 675 | WP_021205614.1 | hypothetical protein | - |
| NLS69_RS07555 (NLS69_07555) | 1595846..1596274 | - | 429 | WP_254575228.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NLS69_RS07560 (NLS69_07560) | 1596321..1596503 | - | 183 | WP_003098540.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NLS69_RS07565 (NLS69_07565) | 1596719..1597240 | + | 522 | WP_158309806.1 | GspH/FimT family pseudopilin | - |
| NLS69_RS07570 (NLS69_07570) | 1597422..1597754 | + | 333 | WP_014602590.1 | phage holin, lambda family | - |
| NLS69_RS07575 (NLS69_07575) | 1597751..1598368 | + | 618 | WP_254575229.1 | glycoside hydrolase family 19 protein | - |
| NLS69_RS07580 (NLS69_07580) | 1598386..1598817 | + | 432 | WP_254575230.1 | hypothetical protein | - |
| NLS69_RS07585 (NLS69_07585) | 1598954..1599358 | + | 405 | WP_014602592.1 | HNH endonuclease | - |
| NLS69_RS07590 (NLS69_07590) | 1599440..1599922 | + | 483 | WP_014602593.1 | phage terminase small subunit P27 family | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1577523..1620075 | 42552 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6746.86 Da Isoelectric Point: 11.0775
>T250907 WP_003098540.1 NZ_CP100653:c1596503-1596321 [Pseudomonas aeruginosa]
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK
Download Length: 183 bp
Antitoxin
Download Length: 143 a.a. Molecular weight: 15815.02 Da Isoelectric Point: 4.6562
>AT250907 WP_254575228.1 NZ_CP100653:c1596274-1595846 [Pseudomonas aeruginosa]
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKAHAISEAVDAIESTLSLYVDQRREIPSASQAQPGERVIHLPAVTVA
KVALWNEMIRRDMRKADLCRLLGIAQIQGDRLVDFLHNTKMEAMENALSAIGLRLSVNIEVA
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKAHAISEAVDAIESTLSLYVDQRREIPSASQAQPGERVIHLPAVTVA
KVALWNEMIRRDMRKADLCRLLGIAQIQGDRLVDFLHNTKMEAMENALSAIGLRLSVNIEVA
Download Length: 429 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|