Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 142073..142578 | Replicon | chromosome |
| Accession | NZ_CP100653 | ||
| Organism | Pseudomonas aeruginosa strain F13 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A069QL22 |
| Locus tag | NLS69_RS00655 | Protein ID | WP_003121619.1 |
| Coordinates | 142073..142354 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q9I707 |
| Locus tag | NLS69_RS00660 | Protein ID | WP_003112628.1 |
| Coordinates | 142351..142578 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLS69_RS00630 (NLS69_00630) | 137324..138673 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
| NLS69_RS00635 (NLS69_00635) | 138722..139408 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| NLS69_RS00640 (NLS69_00640) | 139509..140243 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| NLS69_RS00645 (NLS69_00645) | 140423..140833 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
| NLS69_RS00650 (NLS69_00650) | 140865..141773 | - | 909 | WP_016561475.1 | LysR family transcriptional regulator | - |
| NLS69_RS00655 (NLS69_00655) | 142073..142354 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| NLS69_RS00660 (NLS69_00660) | 142351..142578 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| NLS69_RS00665 (NLS69_00665) | 142754..143374 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| NLS69_RS00670 (NLS69_00670) | 143475..143975 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
| NLS69_RS00675 (NLS69_00675) | 144048..144389 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| NLS69_RS00680 (NLS69_00680) | 144471..145898 | - | 1428 | WP_003083784.1 | GABA permease | - |
| NLS69_RS00685 (NLS69_00685) | 146067..147560 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T250905 WP_003121619.1 NZ_CP100653:c142354-142073 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A069QL22 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6XRW | |
| AlphaFold DB | Q9I707 |