Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4928180..4928820 | Replicon | chromosome |
Accession | NZ_CP100652 | ||
Organism | Pseudomonas putida strain HSM-C2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NL778_RS22440 | Protein ID | WP_012316423.1 |
Coordinates | 4928410..4928820 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A427FTN1 |
Locus tag | NL778_RS22435 | Protein ID | WP_012316422.1 |
Coordinates | 4928180..4928410 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL778_RS22415 (NL778_22415) | 4923567..4924883 | - | 1317 | WP_254466626.1 | precorrin-3B synthase | - |
NL778_RS22420 (NL778_22420) | 4925074..4926285 | + | 1212 | WP_042111775.1 | bifunctional cobalt-precorrin-7 (C(5))-methyltransferase/cobalt-precorrin-6B (C(15))-methyltransferase | - |
NL778_RS22425 (NL778_22425) | 4926278..4927372 | + | 1095 | WP_012316420.1 | cobalt-precorrin-5B (C(1))-methyltransferase | - |
NL778_RS22430 (NL778_22430) | 4927369..4928088 | + | 720 | WP_254466627.1 | cobalt-precorrin-6A reductase | - |
NL778_RS22435 (NL778_22435) | 4928180..4928410 | + | 231 | WP_012316422.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NL778_RS22440 (NL778_22440) | 4928410..4928820 | + | 411 | WP_012316423.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NL778_RS22445 (NL778_22445) | 4928955..4929392 | + | 438 | WP_012316424.1 | NfeD family protein | - |
NL778_RS22450 (NL778_22450) | 4929417..4930271 | + | 855 | WP_012316425.1 | SPFH domain-containing protein | - |
NL778_RS22455 (NL778_22455) | 4930465..4930854 | + | 390 | WP_012316426.1 | DUF2946 domain-containing protein | - |
NL778_RS22460 (NL778_22460) | 4930903..4931382 | + | 480 | WP_254466629.1 | copper chaperone PCu(A)C | - |
NL778_RS22465 (NL778_22465) | 4931409..4931840 | + | 432 | WP_012316428.1 | DUF2946 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15055.42 Da Isoelectric Point: 8.0998
>T250903 WP_012316423.1 NZ_CP100652:4928410-4928820 [Pseudomonas putida]
MLKYMLDTNICIFTIKNKPQVVREAFNRHHGQLAISTVTLMELVYGAEKSAAPARNLSIVEGFVARLEVLDYDSHAAEHS
GQLRSELAKAGTPIGPFDQLIAGHARARGLTLVTNNLREFMRVPGLRVEDWLAMPG
MLKYMLDTNICIFTIKNKPQVVREAFNRHHGQLAISTVTLMELVYGAEKSAAPARNLSIVEGFVARLEVLDYDSHAAEHS
GQLRSELAKAGTPIGPFDQLIAGHARARGLTLVTNNLREFMRVPGLRVEDWLAMPG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|