Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1378411..1379327 | Replicon | chromosome |
Accession | NZ_CP100651 | ||
Organism | Bacillus halotolerans strain MEC_B334 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | NLW79_RS07130 | Protein ID | WP_106022239.1 |
Coordinates | 1378581..1379327 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | - |
Locus tag | NLW79_RS07125 | Protein ID | WP_106022240.1 |
Coordinates | 1378411..1378581 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLW79_RS07090 (1375279) | 1375279..1375605 | + | 327 | WP_127695404.1 | XkdW family protein | - |
NLW79_RS07095 (1375602) | 1375602..1375766 | + | 165 | WP_015715740.1 | XkdX family protein | - |
NLW79_RS07100 (1375812) | 1375812..1376651 | + | 840 | WP_127695402.1 | phage-like element PBSX protein XepA | - |
NLW79_RS07105 (1376704) | 1376704..1376973 | + | 270 | WP_106020445.1 | hemolysin XhlA family protein | - |
NLW79_RS07110 (1376985) | 1376985..1377248 | + | 264 | WP_024121086.1 | phage holin | - |
NLW79_RS07115 (1377261) | 1377261..1378154 | + | 894 | WP_127695400.1 | N-acetylmuramoyl-L-alanine amidase | - |
NLW79_RS07120 (1378190) | 1378190..1378327 | - | 138 | WP_125825426.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NLW79_RS07125 (1378411) | 1378411..1378581 | - | 171 | WP_106022240.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NLW79_RS07130 (1378581) | 1378581..1379327 | - | 747 | WP_106022239.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NLW79_RS07135 (1379437) | 1379437..1380438 | - | 1002 | WP_024121092.1 | inorganic phosphate transporter | - |
NLW79_RS07140 (1380451) | 1380451..1381068 | - | 618 | WP_010333926.1 | DUF47 domain-containing protein | - |
NLW79_RS07145 (1381344) | 1381344..1382660 | - | 1317 | WP_024121093.1 | serine/threonine exchanger | - |
NLW79_RS07150 (1383055) | 1383055..1384005 | + | 951 | WP_254518202.1 | ring-cleaving dioxygenase | - |
NLW79_RS07155 (1384165) | 1384165..1384245 | + | 81 | Protein_1346 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29048.43 Da Isoelectric Point: 4.4986
>T250892 WP_106022239.1 NZ_CP100651:c1379327-1378581 [Bacillus halotolerans]
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CHYSTQSDKDRLTEHMEDPADAQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CHYSTQSDKDRLTEHMEDPADAQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|