Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 523113..523749 | Replicon | chromosome |
| Accession | NZ_CP100651 | ||
| Organism | Bacillus halotolerans strain MEC_B334 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | NLW79_RS02655 | Protein ID | WP_003156187.1 |
| Coordinates | 523399..523749 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | NLW79_RS02650 | Protein ID | WP_003225183.1 |
| Coordinates | 523113..523394 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLW79_RS02630 (519468) | 519468..520067 | - | 600 | WP_254518054.1 | rhomboid family intramembrane serine protease | - |
| NLW79_RS02635 (520162) | 520162..520527 | + | 366 | WP_106020948.1 | holo-ACP synthase | - |
| NLW79_RS02640 (520693) | 520693..521709 | + | 1017 | WP_106021112.1 | outer membrane lipoprotein carrier protein LolA | - |
| NLW79_RS02645 (521826) | 521826..522995 | + | 1170 | WP_024120297.1 | alanine racemase | - |
| NLW79_RS02650 (523113) | 523113..523394 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| NLW79_RS02655 (523399) | 523399..523749 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| NLW79_RS02660 (523865) | 523865..524689 | + | 825 | WP_081638235.1 | RsbT co-antagonist protein RsbRA | - |
| NLW79_RS02665 (524694) | 524694..525059 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| NLW79_RS02670 (525062) | 525062..525463 | + | 402 | WP_106020946.1 | serine/threonine-protein kinase RsbT | - |
| NLW79_RS02675 (525475) | 525475..526482 | + | 1008 | WP_024120300.1 | phosphoserine phosphatase RsbU | - |
| NLW79_RS02680 (526543) | 526543..526872 | + | 330 | WP_024120301.1 | anti-sigma factor antagonist RsbV | - |
| NLW79_RS02685 (526869) | 526869..527351 | + | 483 | WP_024120302.1 | anti-sigma B factor RsbW | - |
| NLW79_RS02690 (527317) | 527317..528105 | + | 789 | WP_024120303.1 | RNA polymerase sigma factor SigB | - |
| NLW79_RS02695 (528105) | 528105..528704 | + | 600 | WP_024120304.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T250891 WP_003156187.1 NZ_CP100651:523399-523749 [Bacillus halotolerans]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|