Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 1105389..1106138 | Replicon | chromosome |
Accession | NZ_CP100647 | ||
Organism | Xanthomonas sacchari strain DD13 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | NKJ47_RS04500 | Protein ID | WP_254460336.1 |
Coordinates | 1105701..1106138 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | NKJ47_RS04495 | Protein ID | WP_254460335.1 |
Coordinates | 1105389..1105661 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NKJ47_RS04475 | 1101043..1101840 | + | 798 | WP_254460331.1 | hypothetical protein | - |
NKJ47_RS04480 | 1101940..1102629 | + | 690 | WP_254460332.1 | hypothetical protein | - |
NKJ47_RS04485 | 1102779..1104038 | + | 1260 | WP_254460333.1 | MFS transporter | - |
NKJ47_RS04490 | 1104042..1105025 | - | 984 | WP_254460334.1 | NAD(P)-dependent oxidoreductase | - |
NKJ47_RS04495 | 1105389..1105661 | + | 273 | WP_254460335.1 | DUF1778 domain-containing protein | Antitoxin |
NKJ47_RS04500 | 1105701..1106138 | + | 438 | WP_254460336.1 | GNAT family N-acetyltransferase | Toxin |
NKJ47_RS04505 | 1106398..1108290 | + | 1893 | WP_254460337.1 | PEP/pyruvate-binding domain-containing protein | - |
NKJ47_RS04510 | 1108403..1109383 | + | 981 | WP_254460338.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15779.35 Da Isoelectric Point: 8.1629
>T250889 WP_254460336.1 NZ_CP100647:1105701-1106138 [Xanthomonas sacchari]
MLDEFACSAPELSKWLRERALQNQASNASRCFVVCDREERVVGYYALAAGAVSHEEAPGRIRRNMPKAIPVIVLGRLAVH
ADWVGQGIGTGLLKDAVQRALQVGEHIGARALLCHAIDDAAKAFYMKHGFFASPIHAMTVMLPLA
MLDEFACSAPELSKWLRERALQNQASNASRCFVVCDREERVVGYYALAAGAVSHEEAPGRIRRNMPKAIPVIVLGRLAVH
ADWVGQGIGTGLLKDAVQRALQVGEHIGARALLCHAIDDAAKAFYMKHGFFASPIHAMTVMLPLA
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|