Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 148167..148837 Replicon plasmid pwx17388plas
Accession NZ_CP100602
Organism Klebsiella pneumoniae strain WX17388

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NLI98_RS26220 Protein ID WP_004213072.1
Coordinates 148167..148610 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NLI98_RS26225 Protein ID WP_004213073.1
Coordinates 148607..148837 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLI98_RS26185 (NLI98_26170) 143577..143852 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
NLI98_RS26190 (NLI98_26175) 143915..144406 + 492 WP_011251327.1 DM13 domain-containing protein -
NLI98_RS26195 (NLI98_26180) 144455..145375 + 921 WP_004213934.1 DUF1471 domain-containing protein -
NLI98_RS26200 (NLI98_26185) 145466..145869 + 404 Protein_157 GAF domain-containing protein -
NLI98_RS26205 (NLI98_26190) 146387..147023 - 637 Protein_158 mucoid phenotype regulator RmpA2 -
NLI98_RS26210 (NLI98_26195) 147440..147744 + 305 Protein_159 transposase -
NLI98_RS26215 (NLI98_26200) 147767..148018 - 252 WP_186987481.1 hypothetical protein -
NLI98_RS26220 (NLI98_26205) 148167..148610 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NLI98_RS26225 (NLI98_26210) 148607..148837 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NLI98_RS26230 (NLI98_26215) 149445..150578 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
NLI98_RS26235 (NLI98_26220) 150594..150887 + 294 WP_004213076.1 hypothetical protein -
NLI98_RS26240 (NLI98_26225) 150877..151083 - 207 WP_004213077.1 hypothetical protein -
NLI98_RS26245 (NLI98_26230) 151435..151725 + 291 WP_004213078.1 hypothetical protein -
NLI98_RS26250 (NLI98_26235) 151715..152614 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA2 1..222562 222562


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T250888 WP_004213072.1 NZ_CP100602:c148610-148167 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT250888 WP_004213073.1 NZ_CP100602:c148837-148607 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References