Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 97864..98600 | Replicon | plasmid pwx17388plas |
| Accession | NZ_CP100602 | ||
| Organism | Klebsiella pneumoniae strain WX17388 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A2J5Q928 |
| Locus tag | NLI98_RS25930 | Protein ID | WP_004098919.1 |
| Coordinates | 98118..98600 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
| Locus tag | NLI98_RS25925 | Protein ID | WP_004213599.1 |
| Coordinates | 97864..98130 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLI98_RS25900 (NLI98_25890) | 93096..93653 | + | 558 | WP_004213590.1 | recombinase family protein | - |
| NLI98_RS25905 (NLI98_25895) | 93656..96625 | + | 2970 | WP_004213592.1 | Tn3 family transposase | - |
| NLI98_RS25910 (NLI98_25900) | 96667..97161 | + | 495 | WP_004213594.1 | hypothetical protein | - |
| NLI98_RS25915 (NLI98_25905) | 97222..97425 | + | 204 | WP_004213596.1 | HHA domain-containing protein | - |
| NLI98_RS25920 (NLI98_25910) | 97439..97669 | + | 231 | WP_004213598.1 | hypothetical protein | - |
| NLI98_RS25925 (NLI98_25915) | 97864..98130 | + | 267 | WP_004213599.1 | DUF1778 domain-containing protein | Antitoxin |
| NLI98_RS25930 (NLI98_25920) | 98118..98600 | + | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
| NLI98_RS25935 (NLI98_25925) | 99021..100248 | + | 1228 | Protein_104 | IS3 family transposase | - |
| NLI98_RS25940 (NLI98_25930) | 100244..100639 | - | 396 | Protein_105 | IS3 family transposase | - |
| NLI98_RS25945 (NLI98_25935) | 100814..101836 | - | 1023 | WP_004214536.1 | porphobilinogen synthase | - |
| NLI98_RS25950 (NLI98_25940) | 101900..103246 | - | 1347 | WP_011154555.1 | dihydroorotase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..222562 | 222562 | |
| - | inside | IScluster/Tn | - | - | 93096..100248 | 7152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T250887 WP_004098919.1 NZ_CP100602:98118-98600 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J5Q928 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D3T1D0 |