Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 42751..43661 Replicon plasmid pwx17388plas
Accession NZ_CP100602
Organism Klebsiella pneumoniae strain WX17388

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag NLI98_RS25670 Protein ID WP_004026354.1
Coordinates 43191..43661 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag NLI98_RS25665 Protein ID WP_004026357.1
Coordinates 42751..43194 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLI98_RS25635 (NLI98_25625) 37769..38290 + 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -
NLI98_RS25640 (NLI98_25630) 38287..39240 + 954 Protein_45 fec operon regulator FecR -
NLI98_RS25645 (NLI98_25635) 39327..41453 + 2127 WP_004213640.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
NLI98_RS25650 (NLI98_25640) 41528..41647 + 120 Protein_47 Fe3+-citrate ABC transporter substrate-binding protein -
NLI98_RS25655 (NLI98_25645) 41828..42049 + 222 WP_004213643.1 DUF2188 domain-containing protein -
NLI98_RS25660 (NLI98_25650) 42147..42650 + 504 Protein_49 DUF4113 domain-containing protein -
NLI98_RS25665 (NLI98_25655) 42751..43194 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
NLI98_RS25670 (NLI98_25660) 43191..43661 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
NLI98_RS25675 (NLI98_25665) 44175..44872 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
NLI98_RS25680 (NLI98_25670) 46258..46908 - 651 WP_068893702.1 DUF1173 family protein -
NLI98_RS25685 (NLI98_25675) 46941..47207 - 267 WP_223175074.1 DUF1173 family protein -
NLI98_RS25690 (NLI98_25680) 47385..47879 + 495 WP_004212794.1 thermonuclease family protein -
NLI98_RS25695 (NLI98_25685) 48216..48614 + 399 WP_004212796.1 H-NS family nucleoid-associated regulatory protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA2 1..222562 222562
- flank IS/Tn - - 44369..44872 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T250886 WP_004026354.1 NZ_CP100602:43191-43661 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT250886 WP_004026357.1 NZ_CP100602:42751-43194 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References