Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 42751..43661 | Replicon | plasmid pwx17388plas |
| Accession | NZ_CP100602 | ||
| Organism | Klebsiella pneumoniae strain WX17388 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A663AYG0 |
| Locus tag | NLI98_RS25670 | Protein ID | WP_004026354.1 |
| Coordinates | 43191..43661 (+) | Length | 157 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A6P1V3Q9 |
| Locus tag | NLI98_RS25665 | Protein ID | WP_004026357.1 |
| Coordinates | 42751..43194 (+) | Length | 148 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLI98_RS25635 (NLI98_25625) | 37769..38290 | + | 522 | WP_004213635.1 | ferric citrate uptake sigma factor FecI | - |
| NLI98_RS25640 (NLI98_25630) | 38287..39240 | + | 954 | Protein_45 | fec operon regulator FecR | - |
| NLI98_RS25645 (NLI98_25635) | 39327..41453 | + | 2127 | WP_004213640.1 | TonB-dependent Fe(3+) dicitrate receptor FecA | - |
| NLI98_RS25650 (NLI98_25640) | 41528..41647 | + | 120 | Protein_47 | Fe3+-citrate ABC transporter substrate-binding protein | - |
| NLI98_RS25655 (NLI98_25645) | 41828..42049 | + | 222 | WP_004213643.1 | DUF2188 domain-containing protein | - |
| NLI98_RS25660 (NLI98_25650) | 42147..42650 | + | 504 | Protein_49 | DUF4113 domain-containing protein | - |
| NLI98_RS25665 (NLI98_25655) | 42751..43194 | + | 444 | WP_004026357.1 | DUF2384 domain-containing protein | Antitoxin |
| NLI98_RS25670 (NLI98_25660) | 43191..43661 | + | 471 | WP_004026354.1 | RES family NAD+ phosphorylase | Toxin |
| NLI98_RS25675 (NLI98_25665) | 44175..44872 | + | 698 | WP_223175001.1 | IS1-like element IS1A family transposase | - |
| NLI98_RS25680 (NLI98_25670) | 46258..46908 | - | 651 | WP_068893702.1 | DUF1173 family protein | - |
| NLI98_RS25685 (NLI98_25675) | 46941..47207 | - | 267 | WP_223175074.1 | DUF1173 family protein | - |
| NLI98_RS25690 (NLI98_25680) | 47385..47879 | + | 495 | WP_004212794.1 | thermonuclease family protein | - |
| NLI98_RS25695 (NLI98_25685) | 48216..48614 | + | 399 | WP_004212796.1 | H-NS family nucleoid-associated regulatory protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..222562 | 222562 | |
| - | flank | IS/Tn | - | - | 44369..44872 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17515.79 Da Isoelectric Point: 4.6155
>T250886 WP_004026354.1 NZ_CP100602:43191-43661 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16480.80 Da Isoelectric Point: 10.2498
>AT250886 WP_004026357.1 NZ_CP100602:42751-43194 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A663AYG0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6P1V3Q9 |