Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2736133..2736704 | Replicon | chromosome |
| Accession | NZ_CP100596 | ||
| Organism | Enterococcus faecalis strain Chr-JH 2-2 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NLG43_RS13380 | Protein ID | WP_002354774.1 |
| Coordinates | 2736133..2736474 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | NLG43_RS13385 | Protein ID | WP_002354773.1 |
| Coordinates | 2736474..2736704 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLG43_RS13375 (2732148) | 2732148..2735762 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| NLG43_RS13380 (2736133) | 2736133..2736474 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NLG43_RS13385 (2736474) | 2736474..2736704 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| NLG43_RS13390 (2737109) | 2737109..2737324 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| NLG43_RS13395 (2737463) | 2737463..2738455 | + | 993 | WP_010817727.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| NLG43_RS13400 (2738719) | 2738719..2739357 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
| NLG43_RS13405 (2740042) | 2740042..2741658 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T250869 WP_002354774.1 NZ_CP100596:c2736474-2736133 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|