Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 2353050..2353745 | Replicon | chromosome |
| Accession | NZ_CP100596 | ||
| Organism | Enterococcus faecalis strain Chr-JH 2-2 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | A0A059N529 |
| Locus tag | NLG43_RS11565 | Protein ID | WP_002373917.1 |
| Coordinates | 2353401..2353745 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | NLG43_RS11560 | Protein ID | WP_010829960.1 |
| Coordinates | 2353050..2353382 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLG43_RS11505 (2348655) | 2348655..2349470 | - | 816 | WP_164742164.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| NLG43_RS11510 (2349433) | 2349433..2350449 | - | 1017 | WP_010821115.1 | RecT family recombinase | - |
| NLG43_RS11515 (2350500) | 2350500..2350754 | + | 255 | WP_002393052.1 | hypothetical protein | - |
| NLG43_RS11520 (2350729) | 2350729..2350911 | - | 183 | WP_258079925.1 | hypothetical protein | - |
| NLG43_RS11525 (2351051) | 2351051..2351275 | - | 225 | WP_002370012.1 | hypothetical protein | - |
| NLG43_RS11530 (2351272) | 2351272..2351571 | - | 300 | WP_002414895.1 | hypothetical protein | - |
| NLG43_RS11535 (2351638) | 2351638..2351826 | - | 189 | WP_127336215.1 | hypothetical protein | - |
| NLG43_RS11540 (2351823) | 2351823..2352041 | - | 219 | WP_010714171.1 | aspartate decarboxylase | - |
| NLG43_RS11545 (2352047) | 2352047..2352247 | - | 201 | WP_127336216.1 | hypothetical protein | - |
| NLG43_RS11550 (2352285) | 2352285..2352554 | - | 270 | WP_002365131.1 | hypothetical protein | - |
| NLG43_RS11555 (2352566) | 2352566..2352757 | - | 192 | WP_105194779.1 | hypothetical protein | - |
| NLG43_RS11560 (2353050) | 2353050..2353382 | + | 333 | WP_010829960.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NLG43_RS11565 (2353401) | 2353401..2353745 | + | 345 | WP_002373917.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| NLG43_RS11570 (2353835) | 2353835..2354599 | + | 765 | WP_010711260.1 | LysM domain-containing protein | - |
| NLG43_RS11575 (2354693) | 2354693..2355340 | - | 648 | WP_252664458.1 | hypothetical protein | - |
| NLG43_RS11580 (2355526) | 2355526..2356707 | + | 1182 | WP_252664456.1 | site-specific integrase | - |
| NLG43_RS11585 (2356810) | 2356810..2356959 | - | 150 | WP_002356321.1 | 50S ribosomal protein L33 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2322078..2356707 | 34629 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13594.61 Da Isoelectric Point: 5.6177
>T250857 WP_002373917.1 NZ_CP100596:2353401-2353745 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEIYLK
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEIYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|