Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 27740..28422 | Replicon | plasmid unnamed |
Accession | NZ_CP100554 | ||
Organism | Pseudomonas hydrolytica strain KHPS2 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | NLY38_RS25605 | Protein ID | WP_254348648.1 |
Coordinates | 28060..28422 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | NLY38_RS25600 | Protein ID | WP_254348646.1 |
Coordinates | 27740..28063 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLY38_RS25565 (NLY38_25565) | 23406..23819 | - | 414 | WP_254348633.1 | plasmid mobilization relaxosome protein MobC | - |
NLY38_RS25570 (NLY38_25570) | 24139..24555 | + | 417 | WP_254348634.1 | type IV secretory system conjugative DNA transfer family protein | - |
NLY38_RS25575 (NLY38_25575) | 24567..25268 | + | 702 | WP_254348635.1 | StbB family protein | - |
NLY38_RS25580 (NLY38_25580) | 25274..25867 | + | 594 | WP_254348637.1 | hypothetical protein | - |
NLY38_RS25585 (NLY38_25585) | 25876..26172 | + | 297 | WP_254348640.1 | TrbM/KikA/MpfK family conjugal transfer protein | - |
NLY38_RS25590 (NLY38_25590) | 26234..26692 | + | 459 | WP_254348642.1 | hypothetical protein | - |
NLY38_RS25595 (NLY38_25595) | 27265..27675 | - | 411 | WP_254348644.1 | hypothetical protein | - |
NLY38_RS25600 (NLY38_25600) | 27740..28063 | - | 324 | WP_254348646.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NLY38_RS25605 (NLY38_25605) | 28060..28422 | - | 363 | WP_254348648.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLY38_RS25610 (NLY38_25610) | 28568..28831 | - | 264 | WP_254348650.1 | hypothetical protein | - |
NLY38_RS25615 (NLY38_25615) | 28877..29428 | - | 552 | WP_254348652.1 | hypothetical protein | - |
NLY38_RS25620 (NLY38_25620) | 29439..29669 | - | 231 | WP_254348654.1 | hypothetical protein | - |
NLY38_RS25625 (NLY38_25625) | 30836..30979 | + | 144 | WP_254348656.1 | hypothetical protein | - |
NLY38_RS25630 (NLY38_25630) | 30976..32748 | - | 1773 | WP_254348657.1 | DNA cytosine methyltransferase | - |
NLY38_RS25635 (NLY38_25635) | 32745..32975 | - | 231 | WP_254348658.1 | hypothetical protein | - |
NLY38_RS25640 (NLY38_25640) | 32989..33390 | - | 402 | WP_254348659.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..83915 | 83915 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13209.32 Da Isoelectric Point: 9.9591
>T250855 WP_254348648.1 NZ_CP100554:c28422-28060 [Pseudomonas hydrolytica]
MEKTIKPLFWVGSARKDLQAMPEDVKDTFGFALHLAQLGRKASETKPLKGFGGAGVLEVVESTVSGTYRAVYTVKFGDAV
YVLHCFQKKSTHGIATPKPDMDVINERLKAAEMHAKGERK
MEKTIKPLFWVGSARKDLQAMPEDVKDTFGFALHLAQLGRKASETKPLKGFGGAGVLEVVESTVSGTYRAVYTVKFGDAV
YVLHCFQKKSTHGIATPKPDMDVINERLKAAEMHAKGERK
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|