Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-StbC |
Location | 1169012..1169673 | Replicon | chromosome |
Accession | NZ_CP100553 | ||
Organism | Pseudomonas hydrolytica strain KHPS2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NLY38_RS05385 | Protein ID | WP_129481803.1 |
Coordinates | 1169012..1169431 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8I0VLZ4 |
Locus tag | NLY38_RS05390 | Protein ID | WP_011921115.1 |
Coordinates | 1169428..1169673 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLY38_RS05340 (NLY38_05340) | 1165005..1165211 | - | 207 | WP_041772873.1 | major capsid protein | - |
NLY38_RS05345 (NLY38_05345) | 1165223..1165426 | - | 204 | WP_012018527.1 | hypothetical protein | - |
NLY38_RS05350 (NLY38_05350) | 1165436..1165615 | - | 180 | WP_012018528.1 | hypothetical protein | - |
NLY38_RS05355 (NLY38_05355) | 1165631..1166002 | - | 372 | WP_254348336.1 | hypothetical protein | - |
NLY38_RS05360 (NLY38_05360) | 1166176..1166448 | - | 273 | WP_254348337.1 | hypothetical protein | - |
NLY38_RS05365 (NLY38_05365) | 1166445..1167086 | - | 642 | WP_254348339.1 | DNA cytosine methyltransferase | - |
NLY38_RS05370 (NLY38_05370) | 1167091..1167390 | - | 300 | WP_254348341.1 | DUF5447 family protein | - |
NLY38_RS05375 (NLY38_05375) | 1167720..1168001 | - | 282 | WP_254348343.1 | DNA-binding protein | - |
NLY38_RS05380 (NLY38_05380) | 1168463..1168756 | + | 294 | WP_254348345.1 | hypothetical protein | - |
NLY38_RS05385 (NLY38_05385) | 1169012..1169431 | - | 420 | WP_129481803.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NLY38_RS05390 (NLY38_05390) | 1169428..1169673 | - | 246 | WP_011921115.1 | Arc family DNA-binding protein | Antitoxin |
NLY38_RS05395 (NLY38_05395) | 1169726..1169977 | - | 252 | Protein_1064 | tyrosine-type recombinase/integrase | - |
NLY38_RS05400 (NLY38_05400) | 1170399..1171292 | + | 894 | WP_254348347.1 | hypothetical protein | - |
NLY38_RS05405 (NLY38_05405) | 1171413..1172519 | + | 1107 | WP_254348349.1 | hypothetical protein | - |
NLY38_RS05410 (NLY38_05410) | 1172757..1173422 | - | 666 | WP_195882877.1 | MBL fold metallo-hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1150722..1179103 | 28381 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15067.30 Da Isoelectric Point: 4.2947
>T250852 WP_129481803.1 NZ_CP100553:c1169431-1169012 [Pseudomonas hydrolytica]
MILLDTNVLSELMRAKPAPQVLEWVDAQPVGDLVITSITVAEILYGIARMPDGKRKQGLLDVASVMFDEDFAGNILPFDA
DAAVHYAEIAAETEAKGRVVDMADAQIAAIGRLHDAVIATRNIRHFETLGVALVDPWSN
MILLDTNVLSELMRAKPAPQVLEWVDAQPVGDLVITSITVAEILYGIARMPDGKRKQGLLDVASVMFDEDFAGNILPFDA
DAAVHYAEIAAETEAKGRVVDMADAQIAAIGRLHDAVIATRNIRHFETLGVALVDPWSN
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|