Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 54178..54779 | Replicon | plasmid pLH09-a-D |
| Accession | NZ_CP100548 | ||
| Organism | Escherichia coli strain LH09-a | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | F4TND7 |
| Locus tag | NLZ06_RS24630 | Protein ID | WP_001216030.1 |
| Coordinates | 54399..54779 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | NLZ06_RS24625 | Protein ID | WP_001190712.1 |
| Coordinates | 54178..54399 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ06_RS24615 (NLZ06_24615) | 51174..52442 | - | 1269 | WP_029401415.1 | restriction endonuclease subunit S | - |
| NLZ06_RS24620 (NLZ06_24620) | 52439..53995 | - | 1557 | WP_029401414.1 | type I restriction-modification system subunit M | - |
| NLZ06_RS24625 (NLZ06_24625) | 54178..54399 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NLZ06_RS24630 (NLZ06_24630) | 54399..54779 | + | 381 | WP_001216030.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NLZ06_RS24635 (NLZ06_24635) | 54784..54963 | + | 180 | WP_000113018.1 | hypothetical protein | - |
| NLZ06_RS24640 (NLZ06_24640) | 54991..56034 | + | 1044 | WP_000648833.1 | DUF968 domain-containing protein | - |
| NLZ06_RS24645 (NLZ06_24645) | 56123..56575 | + | 453 | WP_032305380.1 | hypothetical protein | - |
| NLZ06_RS24650 (NLZ06_24650) | 56662..57855 | + | 1194 | WP_000219604.1 | terminase | - |
| NLZ06_RS24655 (NLZ06_24655) | 57855..59339 | + | 1485 | WP_000124150.1 | terminase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..92693 | 92693 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13601.29 Da Isoelectric Point: 5.1408
>T250849 WP_001216030.1 NZ_CP100548:54399-54779 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEDITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEDITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1W8Q3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |