Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3458241..3459078 | Replicon | chromosome |
Accession | NZ_CP100544 | ||
Organism | Escherichia coli strain LH09-a |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | NLZ06_RS16680 | Protein ID | WP_000227784.1 |
Coordinates | 3458536..3459078 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | NLZ06_RS16675 | Protein ID | WP_001297137.1 |
Coordinates | 3458241..3458552 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ06_RS16650 (3453261) | 3453261..3454208 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
NLZ06_RS16655 (3454230) | 3454230..3456221 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
NLZ06_RS16660 (3456211) | 3456211..3456825 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
NLZ06_RS16665 (3456825) | 3456825..3457154 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NLZ06_RS16670 (3457166) | 3457166..3458056 | + | 891 | WP_000971336.1 | heme o synthase | - |
NLZ06_RS16675 (3458241) | 3458241..3458552 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
NLZ06_RS16680 (3458536) | 3458536..3459078 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
NLZ06_RS16685 (3459134) | 3459134..3460069 | - | 936 | WP_001365761.1 | tetratricopeptide repeat protein | - |
NLZ06_RS16690 (3460477) | 3460477..3461841 | + | 1365 | WP_001000975.1 | MFS transporter | - |
NLZ06_RS16695 (3461969) | 3461969..3462460 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
NLZ06_RS16700 (3462628) | 3462628..3463539 | + | 912 | WP_000705877.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T250835 WP_000227784.1 NZ_CP100544:3458536-3459078 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|