Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3424164..3424782 | Replicon | chromosome |
Accession | NZ_CP100544 | ||
Organism | Escherichia coli strain LH09-a |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NLZ06_RS16510 | Protein ID | WP_001291435.1 |
Coordinates | 3424564..3424782 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NLZ06_RS16505 | Protein ID | WP_000344800.1 |
Coordinates | 3424164..3424538 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ06_RS16495 (3419253) | 3419253..3420446 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NLZ06_RS16500 (3420469) | 3420469..3423618 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NLZ06_RS16505 (3424164) | 3424164..3424538 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NLZ06_RS16510 (3424564) | 3424564..3424782 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NLZ06_RS16515 (3424954) | 3424954..3425505 | + | 552 | WP_254521253.1 | maltose O-acetyltransferase | - |
NLZ06_RS16520 (3425621) | 3425621..3426091 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NLZ06_RS16525 (3426255) | 3426255..3427805 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NLZ06_RS16530 (3427847) | 3427847..3428200 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
NLZ06_RS16540 (3428579) | 3428579..3428890 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NLZ06_RS16545 (3428921) | 3428921..3429493 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T250834 WP_001291435.1 NZ_CP100544:3424564-3424782 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT250834 WP_000344800.1 NZ_CP100544:3424164-3424538 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |