Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1283896..1284521 | Replicon | chromosome |
| Accession | NZ_CP100544 | ||
| Organism | Escherichia coli strain LH09-a | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NLZ06_RS06210 | Protein ID | WP_000911330.1 |
| Coordinates | 1284123..1284521 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | NLZ06_RS06205 | Protein ID | WP_000450524.1 |
| Coordinates | 1283896..1284123 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ06_RS06180 (1279699) | 1279699..1280169 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| NLZ06_RS06185 (1280169) | 1280169..1280741 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| NLZ06_RS06190 (1280887) | 1280887..1281765 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| NLZ06_RS06195 (1281782) | 1281782..1282816 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| NLZ06_RS06200 (1283029) | 1283029..1283742 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| NLZ06_RS06205 (1283896) | 1283896..1284123 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NLZ06_RS06210 (1284123) | 1284123..1284521 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NLZ06_RS06215 (1284668) | 1284668..1285531 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
| NLZ06_RS06220 (1285546) | 1285546..1287561 | + | 2016 | WP_000829355.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| NLZ06_RS06225 (1287635) | 1287635..1288333 | + | 699 | WP_000679823.1 | esterase | - |
| NLZ06_RS06230 (1288443) | 1288443..1288643 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T250827 WP_000911330.1 NZ_CP100544:1284123-1284521 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|