Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 4538619..4539429 | Replicon | chromosome |
| Accession | NZ_CP100542 | ||
| Organism | Klebsiella pneumoniae strain LH09-d | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | NLZ07_RS22300 | Protein ID | WP_040225378.1 |
| Coordinates | 4538619..4539152 (-) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | J2E9Q7 |
| Locus tag | NLZ07_RS22305 | Protein ID | WP_002887278.1 |
| Coordinates | 4539163..4539429 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ07_RS22295 (4537450) | 4537450..4538571 | + | 1122 | WP_002887282.1 | cupin domain-containing protein | - |
| NLZ07_RS22300 (4538619) | 4538619..4539152 | - | 534 | WP_040225378.1 | type II toxin-antitoxin system toxin KacT | Toxin |
| NLZ07_RS22305 (4539163) | 4539163..4539429 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
| NLZ07_RS22310 (4539532) | 4539532..4540965 | - | 1434 | WP_040225375.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
| NLZ07_RS22315 (4540955) | 4540955..4541638 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
| NLZ07_RS22320 (4541810) | 4541810..4543192 | + | 1383 | WP_040225374.1 | efflux transporter outer membrane subunit | - |
| NLZ07_RS22325 (4543210) | 4543210..4543542 | + | 333 | WP_025368487.1 | cation efflux system protein CusF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19838.70 Da Isoelectric Point: 5.2614
>T250818 WP_040225378.1 NZ_CP100542:c4539152-4538619 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKVFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKVFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|