Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3925159..3925778 Replicon chromosome
Accession NZ_CP100542
Organism Klebsiella pneumoniae strain LH09-d

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NLZ07_RS19340 Protein ID WP_002892050.1
Coordinates 3925560..3925778 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NLZ07_RS19335 Protein ID WP_002892066.1
Coordinates 3925159..3925533 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ07_RS19325 (3920311) 3920311..3921504 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NLZ07_RS19330 (3921527) 3921527..3924673 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NLZ07_RS19335 (3925159) 3925159..3925533 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NLZ07_RS19340 (3925560) 3925560..3925778 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NLZ07_RS19345 (3925937) 3925937..3926503 + 567 WP_002892030.1 maltose O-acetyltransferase -
NLZ07_RS19350 (3926475) 3926475..3926615 - 141 WP_004147370.1 hypothetical protein -
NLZ07_RS19355 (3926636) 3926636..3927106 + 471 WP_002892026.1 YlaC family protein -
NLZ07_RS19360 (3927081) 3927081..3928532 - 1452 WP_023302231.1 PLP-dependent aminotransferase family protein -
NLZ07_RS19365 (3928633) 3928633..3929331 + 699 WP_002892021.1 GNAT family protein -
NLZ07_RS19370 (3929328) 3929328..3929468 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NLZ07_RS19375 (3929468) 3929468..3929731 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T250817 WP_002892050.1 NZ_CP100542:3925560-3925778 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT250817 WP_002892066.1 NZ_CP100542:3925159-3925533 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References