Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 21107..21654 Replicon plasmid pLH10-b-1-C
Accession NZ_CP100533
Organism Escherichia coli strain LH10-b-1

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag NLZ08_RS25805 Protein ID WP_001384452.1
Coordinates 21107..21385 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A3A1Q2G3
Locus tag NLZ08_RS25810 Protein ID WP_042021804.1
Coordinates 21385..21654 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ08_RS25770 (16210) 16210..17136 + 927 WP_080077783.1 hypothetical protein -
NLZ08_RS25775 (17186) 17186..17440 + 255 WP_059291112.1 hypothetical protein -
NLZ08_RS25780 (17938) 17938..18282 + 345 WP_087601730.1 abortive infection protein -
NLZ08_RS25785 (18456) 18456..19457 - 1002 WP_000774874.1 DUF4238 domain-containing protein -
NLZ08_RS25790 (19808) 19808..20065 + 258 WP_000371888.1 hypothetical protein -
NLZ08_RS25795 (20065) 20065..20655 + 591 WP_000194553.1 hypothetical protein -
NLZ08_RS25800 (20675) 20675..21022 - 348 WP_024148462.1 DUF6404 family protein -
NLZ08_RS25805 (21107) 21107..21385 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
NLZ08_RS25810 (21385) 21385..21654 - 270 WP_042021804.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
NLZ08_RS25815 (22047) 22047..23057 + 1011 WP_096984501.1 IS110 family transposase -
NLZ08_RS25820 (24047) 24047..24904 - 858 WP_001697864.1 incFII family plasmid replication initiator RepA -
NLZ08_RS25825 (24923) 24923..25103 - 181 Protein_32 protein CopA/IncA -
NLZ08_RS25830 (25207) 25207..25464 - 258 WP_000083826.1 replication regulatory protein RepA -
NLZ08_RS25835 (25704) 25704..26294 - 591 WP_000766805.1 DUF2726 domain-containing protein -
NLZ08_RS25840 (26332) 26332..26541 - 210 WP_001298565.1 hemolysin expression modulator Hha -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid sitABCD - 1..67280 67280


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T250805 WP_001384452.1 NZ_CP100533:c21385-21107 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10122.48 Da        Isoelectric Point: 10.2879

>AT250805 WP_042021804.1 NZ_CP100533:c21654-21385 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLGRGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A3A1Q2G3

References