Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 98015..98616 Replicon plasmid pLH10-b-1-B
Accession NZ_CP100532
Organism Escherichia coli strain LH10-b-1

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag NLZ08_RS25610 Protein ID WP_001216034.1
Coordinates 98015..98395 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NLZ08_RS25615 Protein ID WP_001190712.1
Coordinates 98395..98616 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ08_RS25585 (NLZ08_25590) 93589..94800 - 1212 WP_254547648.1 terminase -
NLZ08_RS25590 (NLZ08_25595) 95007..96182 + 1176 WP_089581153.1 RNA-guided endonuclease TnpB family protein -
NLZ08_RS25595 (NLZ08_25600) 96219..96671 - 453 WP_032165150.1 Late promoter-activating protein -
NLZ08_RS25600 (NLZ08_25605) 96760..97803 - 1044 WP_122653073.1 DUF968 domain-containing protein -
NLZ08_RS25605 (NLZ08_25610) 97831..98010 - 180 WP_000113018.1 hypothetical protein -
NLZ08_RS25610 (NLZ08_25615) 98015..98395 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NLZ08_RS25615 (NLZ08_25620) 98395..98616 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NLZ08_RS25620 (NLZ08_25625) 98689..99078 - 390 WP_137445834.1 S24 family peptidase -
NLZ08_RS25625 (NLZ08_25630) 99202..99453 - 252 WP_001283837.1 DNA polymerase III subunit theta -
NLZ08_RS25630 (NLZ08_25635) 99486..99836 + 351 WP_000551789.1 hypothetical protein -
NLZ08_RS25635 (NLZ08_25640) 99821..100105 - 285 WP_001142394.1 hypothetical protein -
NLZ08_RS25640 (NLZ08_25645) 100089..100739 - 651 WP_254547650.1 hypothetical protein -
NLZ08_RS25645 (NLZ08_25650) 100721..101095 - 375 WP_000988651.1 hypothetical protein -
NLZ08_RS25650 (NLZ08_25655) 101102..101395 - 294 WP_000268000.1 hypothetical protein -
NLZ08_RS25655 (NLZ08_25660) 101574..101807 - 234 WP_000517420.1 hypothetical protein -
NLZ08_RS25660 (NLZ08_25665) 101884..102144 - 261 WP_000969524.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..102161 102161
- flank IS/Tn - - 95007..96182 1175


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T250804 WP_001216034.1 NZ_CP100532:c98395-98015 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT250804 WP_001190712.1 NZ_CP100532:c98616-98395 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References