Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 69632..70157 Replicon plasmid pLH10-b-1-A
Accession NZ_CP100531
Organism Escherichia coli strain LH10-b-1

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NLZ08_RS24495 Protein ID WP_001159871.1
Coordinates 69852..70157 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag NLZ08_RS24490 Protein ID WP_000813630.1
Coordinates 69632..69850 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ08_RS24460 (NLZ08_24460) 64994..65224 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -
NLZ08_RS24465 (NLZ08_24465) 65221..65637 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
NLZ08_RS24470 (NLZ08_24470) 66199..67411 + 1213 Protein_74 IS3 family transposase -
NLZ08_RS24475 (NLZ08_24475) 67802..68254 + 453 WP_032353631.1 acyltransferase -
NLZ08_RS24480 (NLZ08_24480) 68286..68471 - 186 WP_032353630.1 hypothetical protein -
NLZ08_RS24485 (NLZ08_24485) 68519..68650 - 132 Protein_77 transposase -
NLZ08_RS24490 (NLZ08_24490) 69632..69850 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NLZ08_RS24495 (NLZ08_24495) 69852..70157 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NLZ08_RS24500 (NLZ08_24500) 70158..70967 + 810 WP_045145707.1 site-specific integrase -
NLZ08_RS24505 (NLZ08_24505) 71140..71493 + 354 WP_000864812.1 colicin M immunity protein -
NLZ08_RS24510 (NLZ08_24510) 71543..72358 - 816 WP_032494159.1 lipid II-degrading bacteriocin colicin M -
NLZ08_RS24515 (NLZ08_24515) 72600..73127 + 528 WP_032353548.1 colicin B immunity protein -
NLZ08_RS24520 (NLZ08_24520) 73145..73804 - 660 Protein_84 colicin-like pore-forming protein -
NLZ08_RS24525 (NLZ08_24525) 73865..74562 + 698 WP_103215986.1 IS1-like element IS1A family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..169272 169272
- flank IS/Tn - - 74059..74562 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T250803 WP_001159871.1 NZ_CP100531:69852-70157 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT250803 WP_000813630.1 NZ_CP100531:69632-69850 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References