Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 69632..70157 | Replicon | plasmid pLH10-b-1-A |
| Accession | NZ_CP100531 | ||
| Organism | Escherichia coli strain LH10-b-1 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | NLZ08_RS24495 | Protein ID | WP_001159871.1 |
| Coordinates | 69852..70157 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | NLZ08_RS24490 | Protein ID | WP_000813630.1 |
| Coordinates | 69632..69850 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ08_RS24460 (NLZ08_24460) | 64994..65224 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| NLZ08_RS24465 (NLZ08_24465) | 65221..65637 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| NLZ08_RS24470 (NLZ08_24470) | 66199..67411 | + | 1213 | Protein_74 | IS3 family transposase | - |
| NLZ08_RS24475 (NLZ08_24475) | 67802..68254 | + | 453 | WP_032353631.1 | acyltransferase | - |
| NLZ08_RS24480 (NLZ08_24480) | 68286..68471 | - | 186 | WP_032353630.1 | hypothetical protein | - |
| NLZ08_RS24485 (NLZ08_24485) | 68519..68650 | - | 132 | Protein_77 | transposase | - |
| NLZ08_RS24490 (NLZ08_24490) | 69632..69850 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NLZ08_RS24495 (NLZ08_24495) | 69852..70157 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NLZ08_RS24500 (NLZ08_24500) | 70158..70967 | + | 810 | WP_045145707.1 | site-specific integrase | - |
| NLZ08_RS24505 (NLZ08_24505) | 71140..71493 | + | 354 | WP_000864812.1 | colicin M immunity protein | - |
| NLZ08_RS24510 (NLZ08_24510) | 71543..72358 | - | 816 | WP_032494159.1 | lipid II-degrading bacteriocin colicin M | - |
| NLZ08_RS24515 (NLZ08_24515) | 72600..73127 | + | 528 | WP_032353548.1 | colicin B immunity protein | - |
| NLZ08_RS24520 (NLZ08_24520) | 73145..73804 | - | 660 | Protein_84 | colicin-like pore-forming protein | - |
| NLZ08_RS24525 (NLZ08_24525) | 73865..74562 | + | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..169272 | 169272 | |
| - | flank | IS/Tn | - | - | 74059..74562 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T250803 WP_001159871.1 NZ_CP100531:69852-70157 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |