Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 64994..65637 Replicon plasmid pLH10-b-1-A
Accession NZ_CP100531
Organism Escherichia coli strain LH10-b-1

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag NLZ08_RS24465 Protein ID WP_001034046.1
Coordinates 65221..65637 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag NLZ08_RS24460 Protein ID WP_001261278.1
Coordinates 64994..65224 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ08_RS24440 (NLZ08_24440) 61329..62189 - 861 WP_001442105.1 DUF2877 domain-containing protein -
NLZ08_RS24445 (NLZ08_24445) 62195..62863 - 669 WP_032353458.1 cysteine hydrolase -
NLZ08_RS24450 (NLZ08_24450) 63149..63217 - 69 Protein_70 hypothetical protein -
NLZ08_RS24455 (NLZ08_24455) 63322..64809 - 1488 Protein_71 IncI1-type relaxase NikB -
NLZ08_RS24460 (NLZ08_24460) 64994..65224 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NLZ08_RS24465 (NLZ08_24465) 65221..65637 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
NLZ08_RS24470 (NLZ08_24470) 66199..67411 + 1213 Protein_74 IS3 family transposase -
NLZ08_RS24475 (NLZ08_24475) 67802..68254 + 453 WP_032353631.1 acyltransferase -
NLZ08_RS24480 (NLZ08_24480) 68286..68471 - 186 WP_032353630.1 hypothetical protein -
NLZ08_RS24485 (NLZ08_24485) 68519..68650 - 132 Protein_77 transposase -
NLZ08_RS24490 (NLZ08_24490) 69632..69850 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
NLZ08_RS24495 (NLZ08_24495) 69852..70157 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..169272 169272


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T250802 WP_001034046.1 NZ_CP100531:65221-65637 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT250802 WP_001261278.1 NZ_CP100531:64994-65224 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References