Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 64994..65637 | Replicon | plasmid pLH10-b-1-A |
| Accession | NZ_CP100531 | ||
| Organism | Escherichia coli strain LH10-b-1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | NLZ08_RS24465 | Protein ID | WP_001034046.1 |
| Coordinates | 65221..65637 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | V0SR71 |
| Locus tag | NLZ08_RS24460 | Protein ID | WP_001261278.1 |
| Coordinates | 64994..65224 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ08_RS24440 (NLZ08_24440) | 61329..62189 | - | 861 | WP_001442105.1 | DUF2877 domain-containing protein | - |
| NLZ08_RS24445 (NLZ08_24445) | 62195..62863 | - | 669 | WP_032353458.1 | cysteine hydrolase | - |
| NLZ08_RS24450 (NLZ08_24450) | 63149..63217 | - | 69 | Protein_70 | hypothetical protein | - |
| NLZ08_RS24455 (NLZ08_24455) | 63322..64809 | - | 1488 | Protein_71 | IncI1-type relaxase NikB | - |
| NLZ08_RS24460 (NLZ08_24460) | 64994..65224 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NLZ08_RS24465 (NLZ08_24465) | 65221..65637 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NLZ08_RS24470 (NLZ08_24470) | 66199..67411 | + | 1213 | Protein_74 | IS3 family transposase | - |
| NLZ08_RS24475 (NLZ08_24475) | 67802..68254 | + | 453 | WP_032353631.1 | acyltransferase | - |
| NLZ08_RS24480 (NLZ08_24480) | 68286..68471 | - | 186 | WP_032353630.1 | hypothetical protein | - |
| NLZ08_RS24485 (NLZ08_24485) | 68519..68650 | - | 132 | Protein_77 | transposase | - |
| NLZ08_RS24490 (NLZ08_24490) | 69632..69850 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| NLZ08_RS24495 (NLZ08_24495) | 69852..70157 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..169272 | 169272 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T250802 WP_001034046.1 NZ_CP100531:65221-65637 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9NXF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SR71 |