Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3674421..3675258 | Replicon | chromosome |
Accession | NZ_CP100530 | ||
Organism | Escherichia coli strain LH10-b-1 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | A0A140NB16 |
Locus tag | NLZ08_RS18175 | Protein ID | WP_000227786.1 |
Coordinates | 3674716..3675258 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | NLZ08_RS18170 | Protein ID | WP_001297137.1 |
Coordinates | 3674421..3674732 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ08_RS18145 (3669441) | 3669441..3670388 | + | 948 | WP_001239440.1 | cytochrome o ubiquinol oxidase subunit II | - |
NLZ08_RS18150 (3670410) | 3670410..3672401 | + | 1992 | WP_254547525.1 | cytochrome o ubiquinol oxidase subunit I | - |
NLZ08_RS18155 (3672391) | 3672391..3673005 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
NLZ08_RS18160 (3673005) | 3673005..3673334 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NLZ08_RS18165 (3673346) | 3673346..3674236 | + | 891 | WP_000971336.1 | heme o synthase | - |
NLZ08_RS18170 (3674421) | 3674421..3674732 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
NLZ08_RS18175 (3674716) | 3674716..3675258 | + | 543 | WP_000227786.1 | GNAT family N-acetyltransferase | Toxin |
NLZ08_RS18180 (3675314) | 3675314..3676249 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
NLZ08_RS18185 (3676666) | 3676666..3678030 | + | 1365 | WP_001000978.1 | MFS transporter | - |
NLZ08_RS18190 (3678158) | 3678158..3678649 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
NLZ08_RS18195 (3678817) | 3678817..3679728 | + | 912 | WP_000705853.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19794.98 Da Isoelectric Point: 8.3395
>T250792 WP_000227786.1 NZ_CP100530:3674716-3675258 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADSAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADSAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A140NB16 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y6B3 |