Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2536994..2537632 | Replicon | chromosome |
| Accession | NZ_CP100530 | ||
| Organism | Escherichia coli strain LH10-b-1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NLZ08_RS12345 | Protein ID | WP_000813794.1 |
| Coordinates | 2537456..2537632 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NLZ08_RS12340 | Protein ID | WP_001270286.1 |
| Coordinates | 2536994..2537410 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ08_RS12320 (2532146) | 2532146..2533087 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| NLZ08_RS12325 (2533088) | 2533088..2534101 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| NLZ08_RS12330 (2534119) | 2534119..2535264 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| NLZ08_RS12335 (2535509) | 2535509..2536915 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| NLZ08_RS12340 (2536994) | 2536994..2537410 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NLZ08_RS12345 (2537456) | 2537456..2537632 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NLZ08_RS12350 (2537854) | 2537854..2538084 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NLZ08_RS12355 (2538176) | 2538176..2540137 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NLZ08_RS12360 (2540210) | 2540210..2540746 | - | 537 | WP_001668593.1 | DNA-binding transcriptional regulator SutR | - |
| NLZ08_RS12365 (2540838) | 2540838..2542013 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | qnrS1 / blaSHV-12 | sodB / espR1 / espR1 | 2310445..2635036 | 324591 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T250790 WP_000813794.1 NZ_CP100530:c2537632-2537456 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT250790 WP_001270286.1 NZ_CP100530:c2537410-2536994 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|