Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2146899..2147731 Replicon chromosome
Accession NZ_CP100530
Organism Escherichia coli strain LH10-b-1

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0D8W767
Locus tag NLZ08_RS10360 Protein ID WP_000854697.1
Coordinates 2146899..2147273 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0D8WAR2
Locus tag NLZ08_RS10365 Protein ID WP_001354195.1
Coordinates 2147363..2147731 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ08_RS10330 (2142049) 2142049..2142702 - 654 WP_254547608.1 ATP-binding cassette domain-containing protein -
NLZ08_RS10335 (2142702) 2142702..2144237 - 1536 WP_097749445.1 ABC transporter permease subunit -
NLZ08_RS10340 (2144210) 2144210..2145376 - 1167 WP_001215339.1 ABC transporter substrate-binding protein -
NLZ08_RS10345 (2145596) 2145596..2146392 - 797 Protein_2024 DUF4942 domain-containing protein -
NLZ08_RS10350 (2146477) 2146477..2146674 - 198 WP_085975623.1 DUF957 domain-containing protein -
NLZ08_RS10355 (2146750) 2146750..2146902 - 153 Protein_2026 DUF5983 family protein -
NLZ08_RS10360 (2146899) 2146899..2147273 - 375 WP_000854697.1 TA system toxin CbtA family protein Toxin
NLZ08_RS10365 (2147363) 2147363..2147731 - 369 WP_001354195.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NLZ08_RS10370 (2147781) 2147781..2148425 - 645 WP_045146861.1 hypothetical protein -
NLZ08_RS10375 (2148444) 2148444..2148665 - 222 WP_000692303.1 DUF987 domain-containing protein -
NLZ08_RS10380 (2148728) 2148728..2149204 - 477 WP_001354455.1 RadC family protein -
NLZ08_RS10385 (2149220) 2149220..2149699 - 480 WP_000860074.1 antirestriction protein -
NLZ08_RS10390 (2149781) 2149781..2150599 - 819 WP_001234688.1 DUF932 domain-containing protein -
NLZ08_RS10395 (2150700) 2150700..2150852 - 153 WP_001696589.1 DUF905 family protein -
NLZ08_RS10400 (2150858) 2150858..2151535 - 678 WP_001097365.1 hypothetical protein -
NLZ08_RS10405 (2151654) 2151654..2152538 - 885 WP_001696588.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14023.07 Da        Isoelectric Point: 7.1881

>T250788 WP_000854697.1 NZ_CP100530:c2147273-2146899 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFADERVIELHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13708.48 Da        Isoelectric Point: 6.8270

>AT250788 WP_001354195.1 NZ_CP100530:c2147731-2147363 [Escherichia coli]
VSDTLPGTTHHDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQAFPLPMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8W767

Antitoxin

Source ID Structure
AlphaFold DB A0A0D8WAR2

References