Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 953242..953896 | Replicon | chromosome |
Accession | NZ_CP100530 | ||
Organism | Escherichia coli strain LH10-b-1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A140N853 |
Locus tag | NLZ08_RS04620 | Protein ID | WP_000244783.1 |
Coordinates | 953489..953896 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NLZ08_RS04615 | Protein ID | WP_000354046.1 |
Coordinates | 953242..953508 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ08_RS04590 (948411) | 948411..949154 | + | 744 | WP_097749237.1 | SDR family oxidoreductase | - |
NLZ08_RS04595 (949211) | 949211..950644 | - | 1434 | WP_001338826.1 | 6-phospho-beta-glucosidase BglA | - |
NLZ08_RS04600 (950689) | 950689..951000 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
NLZ08_RS04605 (951164) | 951164..951823 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
NLZ08_RS04610 (952019) | 952019..952999 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
NLZ08_RS04615 (953242) | 953242..953508 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NLZ08_RS04620 (953489) | 953489..953896 | + | 408 | WP_000244783.1 | protein YgfX | Toxin |
NLZ08_RS04625 (953936) | 953936..954457 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
NLZ08_RS04630 (954569) | 954569..955465 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NLZ08_RS04635 (955490) | 955490..956200 | + | 711 | WP_000715216.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NLZ08_RS04640 (956206) | 956206..957939 | + | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15962.85 Da Isoelectric Point: 11.2669
>T250781 WP_000244783.1 NZ_CP100530:953489-953896 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEISLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEISLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A140N853 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |