Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 50170..50717 Replicon plasmid pLH13-b-A
Accession NZ_CP100526
Organism Escherichia coli strain LH13-b

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag NLZ09_RS22860 Protein ID WP_001384452.1
Coordinates 50170..50448 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A3A1Q2G3
Locus tag NLZ09_RS22865 Protein ID WP_042021804.1
Coordinates 50448..50717 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ09_RS22825 (45273) 45273..46199 + 927 WP_080077783.1 hypothetical protein -
NLZ09_RS22830 (46249) 46249..46503 + 255 WP_059291112.1 hypothetical protein -
NLZ09_RS22835 (47001) 47001..47345 + 345 WP_087601730.1 abortive infection protein -
NLZ09_RS22840 (47519) 47519..48520 - 1002 WP_000774874.1 DUF4238 domain-containing protein -
NLZ09_RS22845 (48871) 48871..49128 + 258 WP_000371888.1 hypothetical protein -
NLZ09_RS22850 (49128) 49128..49718 + 591 WP_000194553.1 hypothetical protein -
NLZ09_RS22855 (49738) 49738..50085 - 348 WP_024148462.1 DUF6404 family protein -
NLZ09_RS22860 (50170) 50170..50448 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
NLZ09_RS22865 (50448) 50448..50717 - 270 WP_042021804.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
NLZ09_RS22870 (50772) 50772..50930 - 159 WP_000829588.1 hypothetical protein -
NLZ09_RS22875 (51632) 51632..52489 - 858 WP_000130644.1 incFII family plasmid replication initiator RepA -
NLZ09_RS22880 (52482) 52482..52556 - 75 WP_001365705.1 RepA leader peptide Tap -
NLZ09_RS22885 (52794) 52794..53048 - 255 WP_000083830.1 replication regulatory protein RepA -
NLZ09_RS22890 (53288) 53288..53878 - 591 WP_001629336.1 DUF2726 domain-containing protein -
NLZ09_RS22895 (53917) 53917..54126 - 210 WP_001299729.1 hemolysin expression modulator Hha -
NLZ09_RS22900 (54172) 54172..54633 - 462 WP_001825161.1 thermonuclease family protein -
NLZ09_RS22905 (54879) 54879..55091 - 213 WP_001311693.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN 1..121387 121387


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T250770 WP_001384452.1 NZ_CP100526:c50448-50170 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10122.48 Da        Isoelectric Point: 10.2879

>AT250770 WP_042021804.1 NZ_CP100526:c50717-50448 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLGRGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A3A1Q2G3

References