Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4084504..4085099 | Replicon | chromosome |
| Accession | NZ_CP100525 | ||
| Organism | Escherichia coli strain LH13-b | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | A0A827ISR3 |
| Locus tag | NLZ09_RS19970 | Protein ID | WP_061359519.1 |
| Coordinates | 4084504..4084854 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | A0A240D6C8 |
| Locus tag | NLZ09_RS19975 | Protein ID | WP_001223212.1 |
| Coordinates | 4084848..4085099 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ09_RS19950 (4079952) | 4079952..4080974 | - | 1023 | WP_001301928.1 | ABC transporter permease | - |
| NLZ09_RS19955 (4080988) | 4080988..4082491 | - | 1504 | Protein_3903 | sugar ABC transporter ATP-binding protein | - |
| NLZ09_RS19960 (4082631) | 4082631..4083587 | - | 957 | WP_000265942.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| NLZ09_RS19965 (4083897) | 4083897..4084427 | + | 531 | WP_000055070.1 | inorganic diphosphatase | - |
| NLZ09_RS19970 (4084504) | 4084504..4084854 | - | 351 | WP_061359519.1 | endoribonuclease toxin ChpB | Toxin |
| NLZ09_RS19975 (4084848) | 4084848..4085099 | - | 252 | WP_001223212.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| NLZ09_RS19980 (4085311) | 4085311..4085652 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| NLZ09_RS19985 (4085655) | 4085655..4089434 | - | 3780 | WP_061359518.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12506.43 Da Isoelectric Point: 6.4786
>T250768 WP_061359519.1 NZ_CP100525:c4084854-4084504 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARQAKRIGLAADEVVEEALLRLQAVVK
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARQAKRIGLAADEVVEEALLRLQAVVK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A827ISR3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A240D6C8 |