Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3628477..3629324 | Replicon | chromosome |
| Accession | NZ_CP100525 | ||
| Organism | Escherichia coli strain LH13-b | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NLZ09_RS17775 | Protein ID | WP_112044915.1 |
| Coordinates | 3628477..3628866 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NLZ09_RS17780 | Protein ID | WP_112044916.1 |
| Coordinates | 3628956..3629324 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ09_RS17740 (3623529) | 3623529..3623834 | + | 306 | WP_000206733.1 | protein YfdT | - |
| NLZ09_RS17745 (3623834) | 3623834..3624184 | + | 351 | WP_254541822.1 | helix-turn-helix domain-containing protein | - |
| NLZ09_RS17750 (3624106) | 3624106..3625224 | + | 1119 | WP_001132557.1 | tyrosine-type recombinase/integrase | - |
| NLZ09_RS17755 (3625450) | 3625450..3626769 | + | 1320 | WP_000144688.1 | site-specific integrase | - |
| NLZ09_RS17760 (3626862) | 3626862..3627710 | - | 849 | WP_112044913.1 | DUF4942 domain-containing protein | - |
| NLZ09_RS17765 (3627795) | 3627795..3627992 | - | 198 | WP_000839267.1 | DUF957 domain-containing protein | - |
| NLZ09_RS17770 (3628004) | 3628004..3628492 | - | 489 | WP_112044914.1 | DUF5983 family protein | - |
| NLZ09_RS17775 (3628477) | 3628477..3628866 | - | 390 | WP_112044915.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| NLZ09_RS17780 (3628956) | 3628956..3629324 | - | 369 | WP_112044916.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NLZ09_RS17785 (3629374) | 3629374..3630018 | - | 645 | WP_059252084.1 | hypothetical protein | - |
| NLZ09_RS17790 (3630033) | 3630033..3630254 | - | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
| NLZ09_RS17795 (3630323) | 3630323..3630799 | - | 477 | WP_001186747.1 | RadC family protein | - |
| NLZ09_RS17800 (3630814) | 3630814..3631299 | - | 486 | WP_042631074.1 | antirestriction protein | - |
| NLZ09_RS17805 (3631390) | 3631390..3632208 | - | 819 | WP_001234702.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | fimH | 3589233..3667442 | 78209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14459.57 Da Isoelectric Point: 8.7427
>T250765 WP_112044915.1 NZ_CP100525:c3628866-3628477 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKRCNWP
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKRCNWP
Download Length: 390 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13629.35 Da Isoelectric Point: 6.4768
>AT250765 WP_112044916.1 NZ_CP100525:c3629324-3628956 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNSRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNSRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|