Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3415307..3415925 | Replicon | chromosome |
| Accession | NZ_CP100525 | ||
| Organism | Escherichia coli strain LH13-b | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NLZ09_RS16655 | Protein ID | WP_001291435.1 |
| Coordinates | 3415707..3415925 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NLZ09_RS16650 | Protein ID | WP_000344800.1 |
| Coordinates | 3415307..3415681 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ09_RS16640 (3410396) | 3410396..3411589 | + | 1194 | WP_254541811.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NLZ09_RS16645 (3411612) | 3411612..3414761 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| NLZ09_RS16650 (3415307) | 3415307..3415681 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NLZ09_RS16655 (3415707) | 3415707..3415925 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NLZ09_RS16660 (3416097) | 3416097..3416648 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| NLZ09_RS16665 (3416764) | 3416764..3417234 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| NLZ09_RS16670 (3417398) | 3417398..3418948 | + | 1551 | WP_014639849.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NLZ09_RS16675 (3418990) | 3418990..3419343 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| NLZ09_RS16685 (3419722) | 3419722..3420033 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| NLZ09_RS16690 (3420064) | 3420064..3420636 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T250764 WP_001291435.1 NZ_CP100525:3415707-3415925 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT250764 WP_000344800.1 NZ_CP100525:3415307-3415681 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |