Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2373754..2374392 | Replicon | chromosome |
| Accession | NZ_CP100525 | ||
| Organism | Escherichia coli strain LH13-b | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NLZ09_RS11550 | Protein ID | WP_000813794.1 |
| Coordinates | 2374216..2374392 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NLZ09_RS11545 | Protein ID | WP_001270286.1 |
| Coordinates | 2373754..2374170 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ09_RS11525 (2368906) | 2368906..2369847 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| NLZ09_RS11530 (2369848) | 2369848..2370861 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
| NLZ09_RS11535 (2370879) | 2370879..2372024 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| NLZ09_RS11540 (2372269) | 2372269..2373675 | - | 1407 | WP_000760585.1 | PLP-dependent aminotransferase family protein | - |
| NLZ09_RS11545 (2373754) | 2373754..2374170 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NLZ09_RS11550 (2374216) | 2374216..2374392 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NLZ09_RS11555 (2374614) | 2374614..2374844 | + | 231 | WP_154813306.1 | YncJ family protein | - |
| NLZ09_RS11560 (2374936) | 2374936..2376897 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NLZ09_RS11565 (2376970) | 2376970..2377506 | - | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
| NLZ09_RS11570 (2377598) | 2377598..2378773 | + | 1176 | WP_001236251.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2378813..2380078 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T250763 WP_000813794.1 NZ_CP100525:c2374392-2374216 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT250763 WP_001270286.1 NZ_CP100525:c2374170-2373754 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|