Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 972939..973522 | Replicon | chromosome |
| Accession | NZ_CP100525 | ||
| Organism | Escherichia coli strain LH13-b | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NLZ09_RS04720 | Protein ID | WP_136699239.1 |
| Coordinates | 973187..973522 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | NLZ09_RS04715 | Protein ID | WP_000581937.1 |
| Coordinates | 972939..973187 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ09_RS04705 (969278) | 969278..970579 | + | 1302 | WP_136699240.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| NLZ09_RS04710 (970627) | 970627..972861 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| NLZ09_RS04715 (972939) | 972939..973187 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NLZ09_RS04720 (973187) | 973187..973522 | + | 336 | WP_136699239.1 | endoribonuclease MazF | Toxin |
| NLZ09_RS04725 (973593) | 973593..974384 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| NLZ09_RS04730 (974612) | 974612..976249 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| NLZ09_RS04735 (976337) | 976337..977635 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12088.00 Da Isoelectric Point: 8.2618
>T250757 WP_136699239.1 NZ_CP100525:973187-973522 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVSCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVSCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|