Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 127415..128166 | Replicon | plasmid pLH13-d-A |
| Accession | NZ_CP100521 | ||
| Organism | Klebsiella pneumoniae strain LH13-d | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A6P1V716 |
| Locus tag | NLZ10_RS25860 | Protein ID | WP_048978473.1 |
| Coordinates | 127415..127897 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A6P1V8A4 |
| Locus tag | NLZ10_RS25865 | Protein ID | WP_048978474.1 |
| Coordinates | 127888..128166 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ10_RS25845 (NLZ10_25845) | 124577..125545 | + | 969 | Protein_139 | IS5 family transposase | - |
| NLZ10_RS25850 (NLZ10_25850) | 125857..126825 | + | 969 | WP_163354964.1 | IS5-like element IS903B family transposase | - |
| NLZ10_RS25855 (NLZ10_25855) | 126973..127377 | - | 405 | WP_004210282.1 | DUF2251 domain-containing protein | - |
| NLZ10_RS25860 (NLZ10_25860) | 127415..127897 | - | 483 | WP_048978473.1 | GNAT family N-acetyltransferase | Toxin |
| NLZ10_RS25865 (NLZ10_25865) | 127888..128166 | - | 279 | WP_048978474.1 | DUF1778 domain-containing protein | Antitoxin |
| NLZ10_RS25870 (NLZ10_25870) | 130018..130332 | + | 315 | WP_032435789.1 | hypothetical protein | - |
| NLZ10_RS25875 (NLZ10_25875) | 130575..131057 | - | 483 | WP_171996278.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..224507 | 224507 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17763.69 Da Isoelectric Point: 9.4946
>T250752 WP_048978473.1 NZ_CP100521:c127897-127415 [Klebsiella pneumoniae]
MGLRPPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
MGLRPPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6P1V716 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6P1V8A4 |