Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 47695..48221 | Replicon | plasmid pLH13-d-A |
Accession | NZ_CP100521 | ||
Organism | Klebsiella pneumoniae strain LH13-d |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | NLZ10_RS25470 | Protein ID | WP_000323025.1 |
Coordinates | 47934..48221 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | NLZ10_RS25465 | Protein ID | WP_000534858.1 |
Coordinates | 47695..47934 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ10_RS25435 (NLZ10_25435) | 43456..43695 | - | 240 | Protein_57 | Atu4866 domain-containing protein | - |
NLZ10_RS25440 (NLZ10_25440) | 43817..44038 | - | 222 | WP_112029034.1 | DUF1471 domain-containing protein | - |
NLZ10_RS25445 (NLZ10_25445) | 44276..44998 | - | 723 | WP_021314440.1 | SDR family oxidoreductase | - |
NLZ10_RS25450 (NLZ10_25450) | 45097..45996 | + | 900 | WP_112029035.1 | LysR family transcriptional regulator | - |
NLZ10_RS25455 (NLZ10_25455) | 46101..47339 | - | 1239 | WP_145525001.1 | IS110 family transposase | - |
NLZ10_RS25460 (NLZ10_25460) | 47572..47670 | - | 99 | Protein_62 | hypothetical protein | - |
NLZ10_RS25465 (NLZ10_25465) | 47695..47934 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
NLZ10_RS25470 (NLZ10_25470) | 47934..48221 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
NLZ10_RS25475 (NLZ10_25475) | 48288..49322 | - | 1035 | Protein_65 | IS481 family transposase | - |
NLZ10_RS25480 (NLZ10_25480) | 49394..49552 | + | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
NLZ10_RS25485 (NLZ10_25485) | 50157..51131 | + | 975 | WP_049165637.1 | hypothetical protein | - |
NLZ10_RS25490 (NLZ10_25490) | 51329..51706 | - | 378 | WP_049165636.1 | hypothetical protein | - |
NLZ10_RS25495 (NLZ10_25495) | 52023..52235 | + | 213 | WP_046654973.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..224507 | 224507 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T250751 WP_000323025.1 NZ_CP100521:47934-48221 [Klebsiella pneumoniae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|