Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4640186..4640702 | Replicon | chromosome |
| Accession | NZ_CP100520 | ||
| Organism | Klebsiella pneumoniae strain LH13-d | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NLZ10_RS22485 | Protein ID | WP_040237797.1 |
| Coordinates | 4640186..4640470 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | NLZ10_RS22490 | Protein ID | WP_002886901.1 |
| Coordinates | 4640460..4640702 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ10_RS22460 (4635589) | 4635589..4635852 | - | 264 | WP_025368518.1 | PTS sugar transporter subunit IIB | - |
| NLZ10_RS22465 (4635982) | 4635982..4636155 | + | 174 | WP_032412860.1 | hypothetical protein | - |
| NLZ10_RS22470 (4636158) | 4636158..4636901 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| NLZ10_RS22475 (4637258) | 4637258..4639396 | + | 2139 | WP_004222153.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NLZ10_RS22480 (4639718) | 4639718..4640182 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NLZ10_RS22485 (4640186) | 4640186..4640470 | - | 285 | WP_040237797.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLZ10_RS22490 (4640460) | 4640460..4640702 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NLZ10_RS22495 (4640780) | 4640780..4642690 | - | 1911 | WP_117054542.1 | PRD domain-containing protein | - |
| NLZ10_RS22500 (4642713) | 4642713..4643867 | - | 1155 | WP_040237796.1 | lactonase family protein | - |
| NLZ10_RS22505 (4643934) | 4643934..4644674 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11067.91 Da Isoelectric Point: 10.4962
>T250747 WP_040237797.1 NZ_CP100520:c4640470-4640186 [Klebsiella pneumoniae]
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|