Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3932541..3933160 Replicon chromosome
Accession NZ_CP100520
Organism Klebsiella pneumoniae strain LH13-d

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NLZ10_RS19145 Protein ID WP_002892050.1
Coordinates 3932942..3933160 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NLZ10_RS19140 Protein ID WP_002892066.1
Coordinates 3932541..3932915 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ10_RS19130 (3927693) 3927693..3928886 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NLZ10_RS19135 (3928909) 3928909..3932055 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NLZ10_RS19140 (3932541) 3932541..3932915 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NLZ10_RS19145 (3932942) 3932942..3933160 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NLZ10_RS19150 (3933323) 3933323..3933889 + 567 WP_002892030.1 maltose O-acetyltransferase -
NLZ10_RS19155 (3933861) 3933861..3934001 - 141 WP_004147370.1 hypothetical protein -
NLZ10_RS19160 (3934022) 3934022..3934492 + 471 WP_002892026.1 YlaC family protein -
NLZ10_RS19165 (3934467) 3934467..3935918 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NLZ10_RS19170 (3936019) 3936019..3936717 + 699 WP_002892021.1 GNAT family protein -
NLZ10_RS19175 (3936714) 3936714..3936854 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NLZ10_RS19180 (3936854) 3936854..3937117 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T250745 WP_002892050.1 NZ_CP100520:3932942-3933160 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT250745 WP_002892066.1 NZ_CP100520:3932541-3932915 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References