Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 520097..520613 | Replicon | chromosome |
| Accession | NZ_CP100515 | ||
| Organism | Klebsiella pneumoniae strain LH35-d | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | NLZ11_RS02540 | Protein ID | WP_004178374.1 |
| Coordinates | 520329..520613 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NLZ11_RS02535 | Protein ID | WP_254541262.1 |
| Coordinates | 520097..520339 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ11_RS02520 (NLZ11_02520) | 516125..516865 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
| NLZ11_RS02525 (NLZ11_02525) | 516932..518086 | + | 1155 | WP_032415878.1 | lactonase family protein | - |
| NLZ11_RS02530 (NLZ11_02530) | 518109..520019 | + | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
| NLZ11_RS02535 (NLZ11_02535) | 520097..520339 | + | 243 | WP_254541262.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NLZ11_RS02540 (NLZ11_02540) | 520329..520613 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLZ11_RS02545 (NLZ11_02545) | 520617..521081 | - | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NLZ11_RS02550 (NLZ11_02550) | 521410..523548 | - | 2139 | WP_032415880.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NLZ11_RS02555 (NLZ11_02555) | 523905..524648 | - | 744 | WP_159308131.1 | MurR/RpiR family transcriptional regulator | - |
| NLZ11_RS02560 (NLZ11_02560) | 524651..524824 | - | 174 | WP_004146781.1 | hypothetical protein | - |
| NLZ11_RS02565 (NLZ11_02565) | 524954..525217 | + | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T250724 WP_004178374.1 NZ_CP100515:520329-520613 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|