Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 199722..200461 | Replicon | chromosome |
| Accession | NZ_CP100515 | ||
| Organism | Klebsiella pneumoniae strain LH35-d | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | NLZ11_RS00980 | Protein ID | WP_254541253.1 |
| Coordinates | 199976..200461 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | NLZ11_RS00975 | Protein ID | WP_003026799.1 |
| Coordinates | 199722..199988 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ11_RS00960 (NLZ11_00960) | 195227..197296 | + | 2070 | WP_065889575.1 | glycine--tRNA ligase subunit beta | - |
| NLZ11_RS00965 (NLZ11_00965) | 197592..198961 | + | 1370 | WP_087791351.1 | IS3 family transposase | - |
| NLZ11_RS00970 (NLZ11_00970) | 199161..199589 | + | 429 | WP_004901287.1 | GFA family protein | - |
| NLZ11_RS00975 (NLZ11_00975) | 199722..199988 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| NLZ11_RS00980 (NLZ11_00980) | 199976..200461 | + | 486 | WP_254541253.1 | GNAT family N-acetyltransferase | Toxin |
| NLZ11_RS00985 (NLZ11_00985) | 200805..200957 | + | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
| NLZ11_RS00990 (NLZ11_00990) | 201259..202878 | + | 1620 | WP_032432333.1 | ATP-binding cassette domain-containing protein | - |
| NLZ11_RS00995 (NLZ11_00995) | 202977..203189 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| NLZ11_RS01000 (NLZ11_01000) | 203442..203732 | - | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
| NLZ11_RS01005 (NLZ11_01005) | 203978..205333 | - | 1356 | WP_159307981.1 | aromatic acid/H+ symport family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 198236..198961 | 725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17682.47 Da Isoelectric Point: 10.1380
>T250721 WP_254541253.1 NZ_CP100515:199976-200461 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRDLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
LDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRDLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
LDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|