Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4493184..4493841 | Replicon | chromosome |
| Accession | NZ_CP100511 | ||
| Organism | Klebsiella pneumoniae strain LH50-a | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | NLZ12_RS21935 | Protein ID | WP_002916310.1 |
| Coordinates | 4493184..4493594 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | NLZ12_RS21940 | Protein ID | WP_002916312.1 |
| Coordinates | 4493575..4493841 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ12_RS21915 (NLZ12_21915) | 4489184..4490917 | - | 1734 | WP_032105216.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NLZ12_RS21920 (NLZ12_21920) | 4490923..4491636 | - | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NLZ12_RS21925 (NLZ12_21925) | 4491659..4492555 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| NLZ12_RS21930 (NLZ12_21930) | 4492656..4493177 | + | 522 | WP_004144730.1 | flavodoxin FldB | - |
| NLZ12_RS21935 (NLZ12_21935) | 4493184..4493594 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
| NLZ12_RS21940 (NLZ12_21940) | 4493575..4493841 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| NLZ12_RS21945 (NLZ12_21945) | 4494087..4495070 | + | 984 | WP_038435686.1 | tRNA-modifying protein YgfZ | - |
| NLZ12_RS21950 (NLZ12_21950) | 4495221..4495880 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
| NLZ12_RS21955 (NLZ12_21955) | 4496044..4496355 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| NLZ12_RS21960 (NLZ12_21960) | 4496405..4497133 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| NLZ12_RS21965 (NLZ12_21965) | 4497252..4498685 | + | 1434 | WP_254541220.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T250717 WP_002916310.1 NZ_CP100511:c4493594-4493184 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |