Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1259844..1260463 Replicon chromosome
Accession NZ_CP100511
Organism Klebsiella pneumoniae strain LH50-a

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NLZ12_RS06020 Protein ID WP_002892050.1
Coordinates 1259844..1260062 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NLZ12_RS06025 Protein ID WP_002892066.1
Coordinates 1260089..1260463 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ12_RS05985 (NLZ12_05985) 1255891..1256154 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
NLZ12_RS05990 (NLZ12_05990) 1256154..1256294 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NLZ12_RS05995 (NLZ12_05995) 1256291..1256989 - 699 WP_002892021.1 GNAT family protein -
NLZ12_RS06000 (NLZ12_06000) 1257090..1258541 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NLZ12_RS06005 (NLZ12_06005) 1258516..1258986 - 471 WP_002892026.1 YlaC family protein -
NLZ12_RS06010 (NLZ12_06010) 1259007..1259147 + 141 WP_004147370.1 hypothetical protein -
NLZ12_RS06015 (NLZ12_06015) 1259119..1259685 - 567 WP_002892030.1 maltose O-acetyltransferase -
NLZ12_RS06020 (NLZ12_06020) 1259844..1260062 - 219 WP_002892050.1 HHA domain-containing protein Toxin
NLZ12_RS06025 (NLZ12_06025) 1260089..1260463 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NLZ12_RS06030 (NLZ12_06030) 1260949..1264095 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NLZ12_RS06035 (NLZ12_06035) 1264118..1265311 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T250711 WP_002892050.1 NZ_CP100511:c1260062-1259844 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT250711 WP_002892066.1 NZ_CP100511:c1260463-1260089 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References